CAZyme Information: MGYG000004721_00310

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000004721_00310
• CAZy Family: PL11
• CAZyme Description: Rhamnogalacturonan endolyase YesW

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
745	MGYG000004721_4|CGC1	80969.97	5.5171

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004721	2389811	MAG	Denmark	Europe

• Gene Location: Start: 30740; End: 32977 Strand: +

Full Sequence      

MNCKSRILALIAGIALPAGAVQAQWVTPTSQMEKLDRGVVAFKGKTNKNFISWRLLGTDN
PNVTFNVMRNGTVIKSGISGVTYYQDNVSTAQEYQVQTVLDGKVIETSPVATSTTGYYFP
LNLDRPAGGTTPAGDAYTYSPCDCSVGDVDGDGQYEIIVKWDPSNSKDNSQAGYTGNVYL
DCYKLDGTKLWRIDLGKNIRAGAHYTQFLVYDFDGDGKAEVVCKTAPGSKDGDGKYVSSA
ADDATIQNVDNTKDWRYTSGRNIGKMGGGQEWLTIFCGATGNAIHTIFYNPNRNGGLGGE
AAPTKNWKESGTDTSYGNRGERYLATVAYLDGPDKNPSAVMGRGYYTYAYLWAVDFDGSK
LKTRWLHVSESKNKVTVTDANGKKTTNTYYTNTGNSGKSCTLYANGNHNLSCADVDGDGK
DEILYGSAAVDDDGSLLYAVGWGHGDAMHVSKLIPDRAGLQVFDVHEEDPYGWDVHDAAT
GEVLYYASGANDNGRGLAADIMPNERGLQFWSSNDRTVRSAVTGESVSGAKSQPINFRVY
WGGTLKDDLLDGTSLKDYAGKDYTLYMGQKVLAYGHSASCNSTKSMPCLAADLFGDWREE
IIMWDSSNSSTLNIFSSSETTKYRIPTLMHDHTYRMGITWQNTAYNQPPHLGFYLPDYVA
QATAIKSVDADVADWIALDEGGELRLDVPAGTSVSVAIHDVSGRICWSKTVTGAQKLQIP
TLSPGTYMLKAVSGGNVFMRKFLNR

Enzyme Prediction     

No EC number prediction in MGYG000004721_00310.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL11	31	661	1.1e-220	0.9828473413379074

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10318	RGL11	0.0	32	653	1	564	Rhamnogalacturonan lyase of the polysaccharide lyase family 11. The rhamnogalacturonan lyase of the polysaccharide lyase family 11 (RGL11) cleaves glycoside bonds in polygalacturonan as well as RG (rhamnogalacturonan) type-I through a beta-elimination reaction. Functionally characterized members of this family, YesW and YesX from Bacillus subtilis, cleave glycoside bonds between rhamnose and galacturonic acid residues in the RG-I region of plant cell wall pectin. YesW and YesX work synergistically, with YesW cleaving the glycoside bond of the RG chain endolytically, and YesX converting the resultant oligosaccharides through an exotype reaction. This domain is sometimes found in architectures with non-catalytic carbohydrate-binding modules (CBMs). There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain through a beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
pfam18370	RGI_lyase	4.40e-24	31	112	2	84	Rhamnogalacturonan I lyases beta-sheet domain. This is the beta-sheet domain found in rhamnogalacturonan (RG) lyases, which are responsible for an initial cleavage of the RG type I (RG-I) region of plant cell wall pectin. Polysaccharide lyase family 11 carrying this domain, such as YesW (EC:4.2.2.23) and YesX (EC:4.2.2.24), cleave glycoside bonds between rhamnose and galacturonic acid residues in RG-I through a beta-elimination reaction. Other family members carrying this domain are hemagglutinin A, lysine gingipain (Kgp) and Chitinase C (EC:3.2.1.14).
TIGR04183	Por_Secre_tail	1.15e-07	684	743	11	70	Por secretion system C-terminal sorting domain. Species that include Porphyromonas gingivalis, Fibrobacter succinogenes, Flavobacterium johnsoniae, Cytophaga hutchinsonii, Gramella forsetii, Prevotella intermedia, and Salinibacter ruber average twenty or more copies of a C-terminal domain, represented by this model, associated with sorting to the outer membrane and covalent modification.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGB28791.1	4.67e-276	4	674	2	667
QUT73808.1	1.81e-188	8	658	4	619
SCV07134.1	5.60e-185	10	657	10	622
QRQ54635.1	5.60e-185	10	657	10	622
ALJ47736.1	5.60e-185	10	657	10	622

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CAG_A	1.73e-175	31	655	10	575	Bacilluslicheniformis Rhamnogalacturonan Lyase PL11 [Bacillus licheniformis]
2Z8R_A	8.40e-172	31	661	4	574	Crystalstructure of rhamnogalacturonan lyase YesW at 1.40 A resolution [Bacillus subtilis],2Z8R_B Crystal structure of rhamnogalacturonan lyase YesW at 1.40 A resolution [Bacillus subtilis],2Z8S_A Crystal structure of rhamnogalacturonan lyase YesW complexed with digalacturonic acid [Bacillus subtilis],2Z8S_B Crystal structure of rhamnogalacturonan lyase YesW complexed with digalacturonic acid [Bacillus subtilis],2ZUX_A Crystal structure of rhamnogalacturonan lyase YesW complexed with rhamnose [Bacillus subtilis],2ZUX_B Crystal structure of rhamnogalacturonan lyase YesW complexed with rhamnose [Bacillus subtilis]
2ZUY_A	1.23e-158	31	655	7	589	Crystalstructure of exotype rhamnogalacturonan lyase YesX [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31526	1.19e-170	31	661	41	611	Rhamnogalacturonan endolyase YesW OS=Bacillus subtilis (strain 168) OX=224308 GN=yesW PE=1 SV=1
O31527	5.21e-158	31	655	7	589	Rhamnogalacturonan exolyase YesX OS=Bacillus subtilis (strain 168) OX=224308 GN=yesX PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000370	0.998856	0.000219	0.000201	0.000168	0.000155

TMHMM  Annotations     

start	end
7	26