CAZyme Information: MGYG000004721_01190

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000004721_01190
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
492	MGYG000004721_23|CGC1	53953.27	8.0628

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004721	2389811	MAG	Denmark	Europe

• Gene Location: Start: 31522; End: 33000 Strand: +

Full Sequence      

MKLKQVILTAAAVLFIGSPTKAQTPAFNPTEMEAGLNAMADSLTANLTPWQVPARDFDIR
KYGAQSGNKHINTRAIQRAIDACAKAGGGRVVVRGGDYVTGTIVLRSGVMLHIDKGARLL
GSTSLKDYPDHVEAFRSVCRDVHRYRISLIYAERADRVGISGEGEIDFRGSRDNFPGPET
VSAIEGRPFGIRMIECKNVVVKDVQLRDAAAWMQCYLVCENLIFDGMRVVNQVNWNNDGL
DLDGCRNVIVRHCNINSHDDALCLKTASGRANENFLVEDNTFHTHCNAFKFGTDSQGAYR
RVVGRRLVLGATPQGEKSFNDIHECSTGITLATTDGGNVSDVLLTDISITGARAPIYLGV
GNRGRRWQSVMEHPGKLHRIVIKHVLGMDCRRQGSLINGCQGFRVSDVLLKDIHATTVGG
GTQAMADAAVEEKSGGYPDAQEWSREGLPAYGFYVRHAERITFDDVKVKPGANEARPHIR
IAQDCEDIVFKK

Enzyme Prediction     

No EC number prediction in MGYG000004721_01190.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	81	421	7.6e-49	0.9323076923076923

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5434	Pgu1	3.74e-38	28	308	61	365	Polygalacturonase [Carbohydrate transport and metabolism].
pfam00295	Glyco_hydro_28	0.009	150	282	48	178	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABR39829.1	8.42e-195	1	488	3	490
QUT62830.1	9.28e-190	1	488	3	490
QUT68392.1	9.28e-190	1	488	3	490
QDM08768.1	9.28e-190	1	488	3	490
QUT58834.1	9.28e-190	1	488	3	490

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OLP_A	6.49e-23	53	302	41	320	Galacturonidase[Bacteroides thetaiotaomicron VPI-5482],5OLP_B Galacturonidase [Bacteroides thetaiotaomicron VPI-5482]
3JUR_A	1.29e-20	51	308	22	318	Thecrystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_B The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_C The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_D The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima]
4MXN_A	1.31e-19	55	256	20	215	Crystalstructure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_B Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_C Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_D Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184]
2UVE_A	2.53e-08	58	129	158	227	Structureof Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVE_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVF_A Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica],2UVF_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P15922	5.51e-11	41	270	137	406	Exo-poly-alpha-D-galacturonosidase OS=Dickeya chrysanthemi OX=556 GN=pehX PE=1 SV=1
P20041	6.78e-07	37	356	42	393	Polygalacturonase OS=Ralstonia solanacearum OX=305 GN=pglA PE=1 SV=1
Q9FY19	1.52e-06	57	358	60	343	Polygalacturonase OS=Juniperus ashei OX=13101 GN=JNA2 PE=1 SV=1
P18192	2.94e-06	73	312	52	302	Endo-polygalacturonase OS=Pectobacterium carotovorum subsp. carotovorum OX=555 GN=peh PE=3 SV=1
Q7M1E7	6.21e-06	57	300	59	312	Polygalacturonase OS=Chamaecyparis obtusa OX=13415 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000268	0.999037	0.000226	0.000158	0.000149	0.000139

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004721_01190.