CAZyme Information: MGYG000004721_01274

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000004721_01274
• CAZy Family: CE12
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
350		39038.82	10.0215

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004721	2389811	MAG	Denmark	Europe

• Gene Location: Start: 24791; End: 25843 Strand: +

Full Sequence      

MHILNKRIKSLLALTIAAVVIIGLSAFKKDKTITIFTIGDSTMANKPIANGNMERGWGMM
LQDCFTEDIRVDNHAQNGRSSKSFINGGLWQPVLDRIKPGDYVFIQFGHNDEKPKADRHT
DPGSTFDDNLRKFVRETRERGGIPVLFNAVVRRIFYYESGQYLQATSGKDIEDEALRKST
NAKDGGKIVEGDTLVDTHGAYLLSPRNVAKEMNVPFVDANKITHDLEQGLGPVTSRKLHM
WYLPGENPAIPKGRKDNTHYNVYGARKVSSLLADAVAKEVPALKKYVRHYDLVVAKNGWG
DYFDLQEAVNAAPTGKKTTILVCEGTWKKPVIGKGKKIKLVLRSDAKLEK

Enzyme Prediction     

No EC number prediction in MGYG000004721_01274.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE12	34	275	1.4e-72	0.9904761904761905

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01821	Rhamnogalacturan_acetylesterase_like	4.86e-76	33	276	1	198	Rhamnogalacturan_acetylesterase_like subgroup of SGNH-hydrolases. Rhamnogalacturan acetylesterase removes acetyl esters from rhamnogalacturonan substrates, and renders them susceptible to degradation by rhamnogalacturonases. Rhamnogalacturonans are highly branched regions in pectic polysaccharides, consisting of repeating -(1,2)-L-Rha-(1,4)-D-GalUA disaccharide units, with many rhamnose residues substituted by neutral oligosaccharides such as arabinans, galactans and arabinogalactans. Extracellular enzymes participating in the degradation of plant cell wall polymers, such as Rhamnogalacturonan acetylesterase, would typically be found in saprophytic and plant pathogenic fungi and bacteria.
COG2755	TesA	3.10e-16	27	284	3	216	Lysophospholipase L1 or related esterase [Amino acid transport and metabolism].
pfam13472	Lipase_GDSL_2	1.41e-08	38	207	2	157	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
cd00229	SGNH_hydrolase	1.37e-07	35	201	1	157	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
PLN02301	PLN02301	6.44e-06	291	337	237	286	pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT66075.1	1.96e-141	6	349	2	330
ADY37158.1	1.10e-127	21	332	13	314
QEW38148.1	1.28e-126	7	342	2	325
ALK82851.1	1.28e-126	7	342	2	325
ABR39491.1	3.52e-126	25	342	15	324

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2O14_A	4.26e-13	34	146	164	274	X-RayCrystal Structure of Protein YXIM_BACsu from Bacillus subtilis. Northeast Structural Genomics Consortium Target SR595 [Bacillus subtilis]
1DEO_A	5.88e-10	34	111	2	75	RHAMNOGALACTURONANACETYLESTERASE FROM ASPERGILLUS ACULEATUS AT 1.55 A RESOLUTION WITH SO4 IN THE ACTIVE SITE [Aspergillus aculeatus],1DEX_A RHAMNOGALACTURONAN ACETYLESTERASE FROM ASPERGILLUS ACULEATUS AT 1.9 A RESOLUTION [Aspergillus aculeatus],1K7C_A Rhamnogalacturonan acetylesterase with seven N-linked carbohydrate residues distributed at two N-glycosylation sites refined at 1.12 A resolution [Aspergillus aculeatus],1PP4_A The crystal structure of rhamnogalacturonan acetylesterase in space group P3121 [Aspergillus aculeatus],1PP4_B The crystal structure of rhamnogalacturonan acetylesterase in space group P3121 [Aspergillus aculeatus]
3C1U_A	5.88e-10	34	111	2	75	ChainA, Rhamnogalacturonan acetylesterase [Aspergillus aculeatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31523	2.80e-40	31	287	4	223	Rhamnogalacturonan acetylesterase RhgT OS=Bacillus subtilis (strain 168) OX=224308 GN=rhgT PE=1 SV=1
O31528	5.00e-27	35	276	5	202	Probable rhamnogalacturonan acetylesterase YesY OS=Bacillus subtilis (strain 168) OX=224308 GN=yesY PE=1 SV=1
P42304	1.25e-13	34	146	179	289	Uncharacterized esterase YxiM OS=Bacillus subtilis (strain 168) OX=224308 GN=yxiM PE=1 SV=2
Q5BAA2	6.39e-12	34	280	19	224	Rhamnogalacturonan acetylesterase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=AN2528 PE=1 SV=1
Q00017	3.88e-09	34	111	19	92	Rhamnogalacturonan acetylesterase OS=Aspergillus aculeatus OX=5053 GN=rha1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.917286	0.057579	0.024205	0.000149	0.000120	0.000668

TMHMM  Annotations     

start	end
10	27