CAZyme Information: MGYG000004722_00029

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; UBA1740
• CAZyme ID: MGYG000004722_00029
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
581	MGYG000004722_1|CGC1	66704.94	4.9784

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004722	1760149	MAG	Denmark	Europe

• Gene Location: Start: 36812; End: 38557 Strand: +

Full Sequence      

MPNLYGIDFTFRNLPENYRADLTPLSDEDGIKRIGVHFDIPENTIPDPVTLVFEIPLINM
MTAYYPLIGQFRQSRSLKPMWIPVTVESRVSGGEPLFSVIGHDENNSFTFTVDDVKTPIR
IYASVIEETARLRMKVEFFYFAPGVLSAYDTALRLDFRTVPYTDALHDAEVYLAEVSGAS
PCYTPEEATYPMYSTWYSYHQKFDTEALIAECREATKMGMHAIIVDDGWQTDDNNRGYAY
CGDWQITPNKIPDIHDLVSRIHALGMKVIFWYSVPFIGKHAALYPHFRDMLLDDPDNDWG
MLDPRFPEVREFLIGKYVEAVRDWHLDGLKLDFIDSFALSSFSKKDDPRMDYADLYAACD
RLMTDVRTAVQNENPKVMIEFRQAYIGTAVQSYGNMFRVGDCPNDALTNRLSAMDMRLVM
HRVAVHSDMLMWHPDDTVESAARQLLNVFFTVPQISVRLSEIRPEHKKMLDHYLSVWTQH
RDVLLFGSFLPEGVDGSYTYLHMDDENEVFKIDFGKNVCRVGDRRPVTYLNVTSKKHIYL
DLVDPRHVTVFAPDGTVTEDRAYPAGIHVVSVPLSGMMTVR

Enzyme Prediction     

No EC number prediction in MGYG000004722_00029.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	184	489	2.7e-33	0.45203488372093026

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	4.23e-62	191	477	4	297	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd06592	GH31_NET37	1.47e-14	189	375	1	199	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
COG3345	GalA	1.34e-10	191	333	293	451	Alpha-galactosidase [Carbohydrate transport and metabolism].
cd14792	GH27	4.86e-07	191	431	2	217	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
COG1649	YddW	7.15e-06	202	347	60	220	Uncharacterized lipoprotein YddW, UPF0748 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBI31507.1	7.16e-140	1	580	1	592
QTH41069.1	8.29e-139	17	578	20	586
CQR57728.1	1.66e-135	16	581	18	588
QJD86820.1	2.11e-135	9	580	9	600
AIQ18885.1	1.86e-134	8	581	10	590

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6PHU_A	5.82e-07	194	332	348	492	SpAgawild type apo structure [Streptococcus pneumoniae TIGR4],6PHV_A Chain A, Alpha-galactosidase [Streptococcus pneumoniae TIGR4]
6PHW_A	7.67e-07	194	295	348	449	ChainA, Alpha-galactosidase [Streptococcus pneumoniae TIGR4],6PHX_A SpAga D472N structure in complex with raffinose [Streptococcus pneumoniae TIGR4],6PHY_A Chain A, Alpha-galactosidase [Streptococcus pneumoniae TIGR4],6PI0_A AgaD472N-Linear Blood group B type 2 trisaccharide complex structure [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5ARP5	2.65e-07	194	332	331	485	Probable alpha-galactosidase G OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=aglG PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004722_00029.