CAZyme Information: MGYG000004723_01250

Basic Information

• Species: Acutalibacter sp900548545
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Acutalibacter; Acutalibacter sp900548545
• CAZyme ID: MGYG000004723_01250
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
808		92659.92	5.3117

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004723	2308372	MAG	China	Asia

• Gene Location: Start: 29394; End: 31820 Strand: -

Full Sequence      

MITQGLHARWTLELPSQEKIPATVPGSVYTALLDAGRLEDPFYRDNEGKALALMEHDYRY
ATVFTPDPAILECPHQVLRFEGVDTVADIRLNGVLLGHVENMHRTFEFDVAGILRPGENG
LQVKLYSPTRWIREKYGEEPADGTSDAMEGFANLRKAHYMFGWDWGPHLPDAGLWRPVSL
LGISGGRLSSVHIRQHHRQGKVKLEIHPELDFVSVKDISYTVWLEDPQGNVEEYAHSPRE
ILVEHPQLWWPRGYGKQPLYTVKVTAFSNGEILDTWQGRIGLRTVTVSREKDAWGESFAH
EVNGVKIFAMGADYIPEDNLLSRVTPERTRKLLEQCAAANFNCIRVWGGGCYPSDAFFDA
CDELGLLVWQDLMFACAVYNLTPAFAQNIREEIRDNVRRLRHHASLGLWCGNNEMELFVD
QGTWVRSHKQKADYIRMYEYLIPEVLQQEDPDTFYWPASPSSGGGFDFPNDPTRGDVHYW
DVWHGQEPFTQYREHTFRYVSEFGFESLPCLATIKTFSQPEDWNLFSYVMERHQRCAKGS
ALMLSYLQQMFLYPTGFETLLYASQLLQAEAIRYGVEHFRRQRGICMGAVYWQLNDCWPV
ASWSSIDYTGRWKALHYYAKRFFAPVLLSCCEEGMLSQQPNVNAEPKPLEKSVRFSVCNE
TMEDRALVVKWALRDKLGNIQREETISLQVAALTSVWMDKVELPDLDPMEEYVSYDLFEG
GRRVSGGTVIFSLAKYFRYADPKLVCRVEGDEIVVAAKAYAKSVEIQNENQDLLLSDNYF
DMNAGETRVKVLSGSTEGLRLRSAYDIR

Enzyme Prediction     

No EC number prediction in MGYG000004723_01250.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	6	698	3.5e-103	0.6835106382978723

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	4.52e-97	20	661	30	680	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	3.15e-13	60	414	113	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam00703	Glyco_hydro_2	3.41e-10	187	283	2	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK10150	PRK10150	4.12e-10	9	287	34	280	beta-D-glucuronidase; Provisional
pfam17753	Ig_mannosidase	2.02e-09	741	806	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQQ93614.1	0.0	1	808	1	823
ASU28856.1	0.0	1	808	1	823
ANU76049.1	0.0	1	808	1	823
QJU13790.1	0.0	1	808	1	823
QBE97789.1	0.0	1	808	15	837

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BYE_A	1.25e-152	1	808	3	848	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	1.28e-152	1	808	3	848	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	9.16e-152	1	808	1	846	Crystalstructure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	9.42e-152	1	808	3	848	Crystalstructure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
2VJX_A	3.54e-147	6	793	11	817	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0CCA0	2.28e-111	22	794	30	828	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
Q4WAH4	4.66e-111	24	798	32	834	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
B0YBU9	1.77e-110	24	798	32	834	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1
A2QYN2	6.61e-110	2	633	9	663	Beta-mannosidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mndB PE=3 SV=1
A1D911	6.76e-110	24	798	32	834	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000019	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004723_01250.