CAZyme Information: MGYG000004724_00751

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Eggerthellaceae; CAG-1427
• CAZyme ID: MGYG000004724_00751
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
836		94789.15	4.7405

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004724	1958666	MAG	China	Asia

• Gene Location: Start: 1263; End: 3773 Strand: -

Full Sequence      

MNVSFRVMRRSGDKAYILSEITGYDKRLPVVLTASTEAGVRIPSDSFPYWNNNDDMELFE
VLSDATLATRGSLVARPHTKNTADVRFFVVVLPWLDIRKWILEFNAVDASGEVVSSCVKR
IDTSSAIWLDKLNDFTNQHRGNAIEGLDGSYIHDRIHVHFLRAVEEDEGVLVTALAEMPY
HEESVIEFDFLDGVGQPKHVDYHVIEDSVDRAVGYGTLDRRYTMITFMVDKNDPSTCVCI
TDTVGQIAPGFAMLGTQCLYELIGSTYNLTIDADEDPDYDYWFDTYHRVDLPTLLEQVAA
RLDYTPLLSLVVYVAQSPMHHLFELAQSLLAQSYGKWELILVNDGSQDTVLNDLMSSLQD
DRIFAVRSTSEASFGDYIQTGIDAAEGEFIGFIRPSNKLAPDALFEFVRKVNDNELCDMI
YCDADIYDAQGVHSSPTLRPDFSPELLRSTNYIRDFIMIRSGVMHAIGDLSQFVEGAFFY
DLVLRSTEAARQVCHVPRILCHKRYATTNLPADYDVARAQEAGRRALVNHCQRVGIKAEI
LSTDRQKCYYVRHVLTSTPLVSIIIPTQDNAHEVMQCLLSIKAKIHYTNYEVLILDGGST
DPDTWKTYEQITQRFSQAQIVTIEDRSNRAEFLNKAVAQAKGEFILFLNDDVRVLTEDAL
EAMLGYFQLDDVGVVGAKRLFIDNTVEHTGLLVGGDTQEHISTPLFKFMPHDWEGYQHRA
QLAQNVSAVSGDCMMVRRAMFDKVGGFTPEFATFYPHLDFCMKAQQAGYYVVFTPHVVLS
HFKSISQTHTYSEELSLQLRREAAYFQYLWPRIFVEGDPYSNPNLDPTSPYFALKW

Enzyme Prediction     

No EC number prediction in MGYG000004724_00751.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	562	745	9.2e-22	0.9941176470588236

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	4.89e-48	306	504	1	201	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	2.10e-29	563	782	1	165	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	8.90e-24	557	811	1	249	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	3.65e-18	562	741	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd06423	CESA_like	1.36e-16	563	753	1	178	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACV56006.1	3.91e-161	1	834	1	829
ACV56016.1	4.01e-122	79	831	36	788
ATP53720.1	3.29e-114	81	834	67	823
AZH69456.1	4.81e-113	81	834	67	823
QOY61387.1	3.75e-111	84	834	56	809

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1H7L_A	3.09e-06	328	427	22	129	dTDP-MAGNESIUMCOMPLEX OF SPSA FROM BACILLUS SUBTILIS [Bacillus subtilis],1H7Q_A dTDP-MANGANESE COMPLEX OF SPSA FROM BACILLUS SUBTILIS [Bacillus subtilis],1QG8_A Native (Magnesium-Containing) Spsa From Bacillus Subtilis [Bacillus subtilis],1QGQ_A Udp-manganese Complex Of Spsa From Bacillus Subtilis [Bacillus subtilis],1QGS_A Udp-Magnesium Complex Of Spsa From Bacillus Subtilis [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	4.23e-70	288	835	348	898	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	2.60e-65	293	835	306	841	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q4UM29	9.39e-07	304	750	12	485	Uncharacterized glycosyltransferase RF_0543 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=RF_0543 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004724_00751.