CAZyme Information: MGYG000004726_00455

Basic Information

• Species: Pseudoflavonifractor sp014287675
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; Pseudoflavonifractor; Pseudoflavonifractor sp014287675
• CAZyme ID: MGYG000004726_00455
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1881		201504.97	4.3159

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004726	4217224	Isolate	United States	North America

• Gene Location: Start: 126004; End: 131649 Strand: +

Full Sequence      

MKRMLSILLTVSILLGVLALPAQGAEPGVTVTETTVTIARENYTIQIEKAGFRYGFYRPD
GTVIVDAHTQSGVCFGSAGGVSYPVTESEYTGMEGDTACFAVTNEQGGRAEVKLHLSERY
VQFEILPVPGGAEPAAANLPEVLDAGGEGGALLVKGSLSGVDATVWKLADGLVPVDDYTV
EARVKLPEDGTRSAGVYSHFNAANGFHLFFIKPGMVMLKRLNEDGTSVDFSVSAPVNIQK
DTWYALKLVSTGSRLQGYVDGKLVVDVEDTTASAGLLTGTAGLRADKMDAWFDDFRVTSN
DGQTVYYENDFESGDVEQLRKSLAYVMGADGLELTRAPAAARYLELVGNSLSTAVTGEAD
WRDYTVSAGTSFAKGDEETAHGLIFGYQDENNYYDFRFGAQETLYLCKTVDGVETVVQSA
AKPYGFDKRYVLAATMRDGQITCSLDGETVLTAADGTFTSGLAGVRTKDSTSLTDSFLVT
AASGGELFRDDFAAETLSGDWTVAGSGRVTDGTEEPQPDPEPAEDYYVIDARLAGGIEYM
YGLGDYGAHGNTGMGVRETSNVVGVNRLKEGDFTNKNSTARFISNFSVAPQLGFAQVLFE
SDDKRVAITGDQTLLGVCRAKKVDGLYYFFGTMEEIYGDYKQVRNALGYVDAKPHFEMFG
LGWEAFGSLGWNAYQASVTDTLTDYLESGYNLTWGVIGSGFWKGDRKGLEGTTTSFGMWD
DTADPAGRKDGLPNPRFPDPDGLKQFFGENGMKLLVGLRNHIKLPESYKGVRYGGKSDAS
VDGDFVYEALDKGYFLTNDDGSLYTVSAKYPTGGIEPRGPVGVIDAENPEAVKWFSDHAD
LWGVDGFKEDCMMLQTTHHDDNWNKLQQYMAEEKDNCLIVRNASYCLPGDVLRINDANYG
ANNNSFNNSPDRMVINSLAYAASGQSNVYPDIIGGTGADVHNPAHQNYIVRNAYMAALCP
SQSVGVNVLKMDDQEKKDAAFKAINWHSTYAPYIYDAALKSYETGYPLSMTPLYIAYPED
DAVYDMINSEKRMFQWMLGESVLAAPLFGTDHLTAHSRDVYLPEGRWIQYDTGEVFEGPV
TLKDREAPIDQMPAFIGGKGVLVGEDMEHKGSYFAEVFPVAGKGSVYEYTFVDGATKSTV
TNRNDGWSVSTLEVYDVTAEETVEFEYNEVNGSIKFPFEAGHSYELRGGEGTGAVVSAAL
KAEKTELWIGERAGTALSARLDDGGFAELDGAAVRYRSSDEAVAAVDGAGVIDARAAGTA
EITAEVTLEDRNGVIVTVVSNAVTVEVAASAVEILSPAAEVTEDFGGDLSGWTDHTGGYA
VSGGTLTYLNTDGGARGTIVTAAGIGDDYTIEVDVTPTELIDKKTFGLTFRYQDSNNNYL
FVYTPGTGIRFLKRADNAIKQNVTDSSFTMAAGQTYHFKAVIEGEHFVLYIDGDKILDVE
DDGKSPALTTGPCGMYTSGQRAEYDNVSITSSVTAFPFALSGTARSGDRVALSFAGYEDT
AALSRDGAWSYTVHYLPRGTHGVTARLLSRDGAVLAEAAGSIVVDTDAPVPDRTKLEKAV
ENAKKAELDGMTEASLEVYQAALDAAERLLKGQADQQTLDAAADALDAAVSALERESAVW
GDTAVTTARKKALRELRELYESMDPAGACACRKARLEQALSDGERAVRTAAAKSKVNAAL
ETARTALEAAVCPGDAFTDVGRNAWYHDAVDMMLERGYMEGVGAGRFDADGTLSRAQLVT
ILHRMAGSPAPKGGAEPFADVEAGLWYADAVAWAAENGVVAGDGRGSFRPEGAITREQIA
LILYRYTGAEQPGESGVLAPFTDAGEVSGYAADAMCWAVGLGLISGGAGADGRLCLMPGG
AATRAQIAQILARHLAAQPGE

Enzyme Prediction     

No EC number prediction in MGYG000004726_00455.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	627	1098	1.5e-37	0.9859484777517564
CBM66	1309	1467	2.4e-18	0.9806451612903225

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1501	YicI	4.21e-42	663	1175	264	759	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
cd06592	GH31_NET37	2.70e-31	787	1067	90	364	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
pfam01055	Glyco_hydro_31	8.40e-31	736	1098	81	439	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
PRK10426	PRK10426	1.07e-19	692	1119	231	628	alpha-glucosidase; Provisional
NF033190	inl_like_NEAT_1	1.22e-13	1687	1804	633	749	NEAT domain-containing leucine-rich repeat protein. Members of this family have an N-terminal NEAT (near transporter) domain often associated with iron transport, followed by a leucine-rich repeat region with significant sequence similarity to the internalins of Listeria monocytogenes. However, since Bacillus cereus (from which this protein was described, in PMID:16978259) is not considered an intracellular pathogen, and the function may be iron transport rather than internalization, applying the name "internalin" to this family probably would be misleading.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUH44186.1	7.94e-170	541	1189	167	811
AZM44844.1	7.94e-170	529	1189	156	811
QEL00542.1	1.30e-158	541	1186	142	757
QNL51081.1	7.36e-157	524	1186	149	780
QNO38365.1	5.43e-148	528	1184	307	931

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6PNR_A	1.41e-15	769	1118	311	658	ChainA, Alpha-glucosidase [[Eubacterium] rectale],6PNR_C Chain C, Alpha-glucosidase [[Eubacterium] rectale]
5F7C_A	2.96e-09	986	1102	608	715	Crystalstructure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_B Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_C Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_D Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
5X7O_A	6.96e-08	978	1187	564	732	Crystalstructure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase [Paenibacillus sp. 598K],5X7O_B Crystal structure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase [Paenibacillus sp. 598K],5X7P_A Crystal structure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase complexed with acarbose [Paenibacillus sp. 598K],5X7P_B Crystal structure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase complexed with acarbose [Paenibacillus sp. 598K],5X7Q_A Crystal structure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase complexed with maltohexaose [Paenibacillus sp. 598K],5X7Q_B Crystal structure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase complexed with maltohexaose [Paenibacillus sp. 598K],5X7R_A Crystal structure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase complexed with isomaltohexaose [Paenibacillus sp. 598K],5X7R_B Crystal structure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase complexed with isomaltohexaose [Paenibacillus sp. 598K],5X7S_A Crystal structure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase, terbium derivative [Paenibacillus sp. 598K],5X7S_B Crystal structure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase, terbium derivative [Paenibacillus sp. 598K]
2G3M_A	3.78e-07	977	1089	498	600	Crystalstructure of the Sulfolobus solfataricus alpha-glucosidase MalA [Saccharolobus solfataricus],2G3M_B Crystal structure of the Sulfolobus solfataricus alpha-glucosidase MalA [Saccharolobus solfataricus],2G3M_C Crystal structure of the Sulfolobus solfataricus alpha-glucosidase MalA [Saccharolobus solfataricus],2G3M_D Crystal structure of the Sulfolobus solfataricus alpha-glucosidase MalA [Saccharolobus solfataricus],2G3M_E Crystal structure of the Sulfolobus solfataricus alpha-glucosidase MalA [Saccharolobus solfataricus],2G3M_F Crystal structure of the Sulfolobus solfataricus alpha-glucosidase MalA [Saccharolobus solfataricus],2G3N_A Crystal structure of the Sulfolobus solfataricus alpha-glucosidase MalA in complex with beta-octyl-glucopyranoside [Saccharolobus solfataricus],2G3N_B Crystal structure of the Sulfolobus solfataricus alpha-glucosidase MalA in complex with beta-octyl-glucopyranoside [Saccharolobus solfataricus],2G3N_C Crystal structure of the Sulfolobus solfataricus alpha-glucosidase MalA in complex with beta-octyl-glucopyranoside [Saccharolobus solfataricus],2G3N_D Crystal structure of the Sulfolobus solfataricus alpha-glucosidase MalA in complex with beta-octyl-glucopyranoside [Saccharolobus solfataricus],2G3N_E Crystal structure of the Sulfolobus solfataricus alpha-glucosidase MalA in complex with beta-octyl-glucopyranoside [Saccharolobus solfataricus],2G3N_F Crystal structure of the Sulfolobus solfataricus alpha-glucosidase MalA in complex with beta-octyl-glucopyranoside [Saccharolobus solfataricus]
6JR6_A	9.24e-07	975	1096	571	682	Flavobacteriumjohnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR7_A Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P38536	9.69e-11	1697	1871	1682	1851	Amylopullulanase OS=Thermoanaerobacterium thermosulfurigenes OX=33950 GN=amyB PE=3 SV=2
P38535	2.15e-09	1697	1871	908	1077	Exoglucanase XynX OS=Acetivibrio thermocellus OX=1515 GN=xynX PE=3 SV=1
P38537	2.21e-09	1708	1875	45	206	Surface-layer 125 kDa protein OS=Lysinibacillus sphaericus OX=1421 PE=3 SV=1
P36917	1.91e-08	1694	1799	1053	1155	Endo-1,4-beta-xylanase A OS=Thermoanaerobacterium saccharolyticum OX=28896 GN=xynA PE=1 SV=1
Q9F234	1.45e-07	982	1105	565	678	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000277	0.998943	0.000236	0.000181	0.000175	0.000160

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004726_00455.