CAZyme Information: MGYG000004730_00762

Basic Information

• Species: Lysinibacillus fusiformis_D
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_A; Planococcaceae; Lysinibacillus; Lysinibacillus fusiformis_D
• CAZyme ID: MGYG000004730_00762
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
177		20255.63	10.2291

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004730	2818639	MAG	Sweden	Europe

• Gene Location: Start: 99; End: 632 Strand: +

Full Sequence      

MQHDRNIGKGGALKTAFAFIREQKGKCHGVLTVGAHGQHALQDVKLVLTMTKVFSEGIVL
GVRNFHSADSSFLSYWGNRATSLFFELLYHRKLMDTQTGLRYISINELPWLMKVKGERYD
YDTNMLVAALKRKCPIFEVEIGQLRLKKNTIIQYDEITNASTIITRMLMNYLKPRNG

Enzyme Prediction     

No EC number prediction in MGYG000004730_00762.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04179	DPM_DPG-synthase_like	9.27e-14	3	129	61	185	DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.
cd04188	DPG_synthase	4.89e-05	4	139	65	200	DPG_synthase is involved in protein N-linked glycosylation. UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSB11846.1	5.00e-117	1	177	59	235
AUS84964.1	5.83e-116	1	177	59	235
QTB22686.1	4.57e-113	1	177	59	235
QPA54612.1	3.74e-112	1	177	59	235
QPA58962.1	3.74e-112	1	177	59	235

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004730_00762.