CAZyme Information: MGYG000004731_00249

Basic Information

• Species: Bifidobacterium italicum
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Bifidobacteriaceae; Bifidobacterium; Bifidobacterium italicum
• CAZyme ID: MGYG000004731_00249
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
902	MGYG000004731_31|CGC1	100986.19	4.471

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004731	1853599	MAG	China	Asia

• Gene Location: Start: 448; End: 3156 Strand: -

Full Sequence      

MTNTPSTFAPLSSGWTVTAMNPETVPADLRETLTAGIPATVPGEATLDLLNAGLIPDPFD
GDNENKLQWTGDVDWRFTCTFDWHDDGNTRHDLVAYGLDTVATVALNGDPVAQTENCHRS
YRWDIRDLLKDGENVLTVTFMSPVRYSDAEEQRRGYYPHTEHHAFNQIRKPSYSFGWDWG
VDVANAGIWREIGIDSWSGVRLAEVRPLVDVASDGTGILNVHVKVEREGHGRIMNPMDAH
KFQTPVPVHVTLEGYGTMLEADGSVDQGRDETTITIAVPDAKLWWPLGYGDQPLYAVDVK
AGADLQAAWKGRIGFRTTHVDTRADDLGRPFQIYVNDVPVHAHGYNWIPDDAFIARVTKK
DYERGIRDLVESNSNMVRVWGGGIYEADEFYDLCDEYGVMVWQDFMLACAAYPEDPETKE
EVEAEAREAIIRLSSHPSLIVWNGSNENYVAYAEWGGYKQAVRDDDLPANEYGYGEKGWG
DYYYSELFPQLLAELDPTHVYLPSSPMSFTKFTNANWDTDGTMHIWDAWNRKDYRIYAEY
TPRFADEFGYQAPPAWSTLVGAVHDEKLEPFGKQMLVHQKAMGGNYKLARGMRSHLTPGH
LDDVSFGGVVNGKPSDGAHSWLIPTDDWDDIQDWHWACQLQQAHAMKFGVEHMRSLAPVN
AGALIWQLNDDWPVVSWAAVDFNGHRKPVWYASREFFAPRLATIQPRTSEEYRQTHSWEG
VKVGADHFELIVLNDTREPVKDTWTVQRVTFGGDVLATQTIDVDLDATSHKGYTLDDAIV
GYDDPNAELIVATPSDNSFARVVYNPAEVVDQSLAAPAEAFTADARKVDGGVELTVTAKD
YVRDLFVMVDKVDAKAAVKEGLVSLLPGESVTFHITTDADDPQAFTAPNVLRSANDLKRE
AK

Enzyme Prediction     

No EC number prediction in MGYG000004731_00249.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	6	776	6.2e-91	0.6941489361702128

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	4.60e-62	3	710	7	649	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	4.63e-10	97	447	134	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam02836	Glyco_hydro_2_C	8.68e-06	332	452	7	140	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK10150	PRK10150	3.03e-05	102	527	95	465	beta-D-glucuronidase; Provisional
pfam17786	Mannosidase_ig	1.65e-04	726	793	1	70	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATU20093.1	0.0	1	902	1	902
AGW84386.1	0.0	1	900	1	902
AIZ15634.1	0.0	1	899	1	901
ASW23786.1	0.0	1	899	1	901
AII75504.1	0.0	1	900	1	903

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BYE_A	9.02e-119	35	879	31	836	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	9.24e-119	35	879	31	836	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	6.40e-118	35	879	29	834	Crystalstructure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	6.55e-118	35	879	31	836	Crystalstructure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
2VJX_A	7.99e-112	37	877	26	818	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5B7W2	1.12e-87	40	718	31	667	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
Q2TXB7	5.76e-87	10	718	8	667	Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndB PE=3 SV=3
B8NW36	5.76e-87	10	718	8	667	Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndB PE=3 SV=1
A1D911	2.96e-86	10	743	8	695	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1
Q4WAH4	1.49e-85	10	743	8	695	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999958	0.000084	0.000003	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004731_00249.