CAZyme Information: MGYG000004731_00700

Basic Information

• Species: Bifidobacterium italicum
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Bifidobacteriaceae; Bifidobacterium; Bifidobacterium italicum
• CAZyme ID: MGYG000004731_00700
• CAZy Family: CBM25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
409		44340.41	6.5159

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004731	1853599	MAG	China	Asia

• Gene Location: Start: 163; End: 1392 Strand: +

Full Sequence      

MDGDVTDRITVPLNEVDINKEGTYRVRYYVEDSAHNGSWSGRRVTVTTATISSIKVWPKW
TDPGVAPDMGNYAEATWSDGNVTGEGVVWDKIDPEQYATPGNTFTVHGKVRGRDVSTTVT
VRGEAPTIAVESVTINGDGLKDGAITLHTGDTVALKAIVKPDDATKKTVSWSSSSNYIAS
VNAEGKVTANKVGTATITASADGKSSSITVTIPDRFSDVPNGKAFHDEIEWLAANRISQG
NSDGTYGYGKTLSRQDMAIFLYRMAKLEKVEGAESFTPTEADYKRFADVKQGSFAAKEIL
WLAKTGISQGSNGRFNGTAQLTRQDMAIFLYRFAKLAGSKSATDFTPTEEDYAKFKDVKQ
GSFAAKEILWLASERITLGNSDGTFGGNSKLSREAMAAFLYRIHDHLAK

Enzyme Prediction     

No EC number prediction in MGYG000004731_00700.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033190	inl_like_NEAT_1	5.31e-21	216	401	582	749	NEAT domain-containing leucine-rich repeat protein. Members of this family have an N-terminal NEAT (near transporter) domain often associated with iron transport, followed by a leucine-rich repeat region with significant sequence similarity to the internalins of Listeria monocytogenes. However, since Bacillus cereus (from which this protein was described, in PMID:16978259) is not considered an intracellular pathogen, and the function may be iron transport rather than internalization, applying the name "internalin" to this family probably would be misleading.
pfam02368	Big_2	2.29e-09	146	212	11	77	Bacterial Ig-like domain (group 2). This family consists of bacterial domains with an Ig-like fold. Members of this family are found in bacterial and phage surface proteins such as intimins.
COG5492	YjdB	6.51e-09	127	211	178	260	Uncharacterized conserved protein YjdB, contains Ig-like domain [General function prediction only].
NF033190	inl_like_NEAT_1	2.65e-06	286	403	582	690	NEAT domain-containing leucine-rich repeat protein. Members of this family have an N-terminal NEAT (near transporter) domain often associated with iron transport, followed by a leucine-rich repeat region with significant sequence similarity to the internalins of Listeria monocytogenes. However, since Bacillus cereus (from which this protein was described, in PMID:16978259) is not considered an intracellular pathogen, and the function may be iron transport rather than internalization, applying the name "internalin" to this family probably would be misleading.
smart00635	BID_2	2.83e-06	129	211	1	81	Bacterial Ig-like domain 2.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATU19781.1	6.06e-105	44	404	846	1219
ATU19783.1	1.93e-103	81	404	1062	1397
ATU19782.1	1.83e-99	75	404	1269	1610
ATO39556.1	9.31e-97	75	403	1052	1393
ATO39558.1	1.64e-96	37	403	815	1198

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A3R0A696	3.07e-09	132	212	269	351	Alpha-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=blArafA PE=1 SV=1
C6CRV0	1.25e-07	216	336	1345	1461	Endo-1,4-beta-xylanase A OS=Paenibacillus sp. (strain JDR-2) OX=324057 GN=xynA1 PE=1 SV=1
P33747	3.49e-07	136	212	31	117	Uncharacterized protein CA_P0160 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=CA_P0160 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000082	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004731_00700.