CAZyme Information: MGYG000004732_01759

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Gemmiger
• CAZyme ID: MGYG000004732_01759
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
450	MGYG000004732_29|CGC1	50029.42	5.4176

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004732	2775580	MAG	China	Asia

• Gene Location: Start: 7027; End: 8379 Strand: -

Full Sequence      

MKRHFWRQALHLEPPAGWLNDPNGLAWFGGKYHVFFQYCPQSAQGRGPKCWGHYESPDLV
NWTFTGAPLQPGGPCDRGDAYSGSAVEENGTLWLYYTGNYKAPGPHDYILTGRDHNTLRV
AFDGRTCVGEKQLLLSNADYPEDCTLHVRDPKVWQGADGVWRMVLGARGRDNTGRVLLYH
GPDGARWTLARVLTKADFGYMWECPDCFELDGRWYLSASPQGLPHGETRYQNIYQSGYFP
LAGDPETGELLDFYEWDMGFDFYAPQTFLAPDGRRLLIAWMGMPDADYHNPTAALGWQHC
LTLPREVFSAPDGRLCQRPARELEALCGDFAPLPDALDLAAPLRLRGKAHGPARLALGGL
VLDFDPAGLCTLSFADDSGAGRDVRRMPVEPGPVTFDIWVDRSGVEVFLNGGRTVAATRF
YPPEGPLPLRAQGVQAEYAPLACPKMQELS

Enzyme Prediction     

No EC number prediction in MGYG000004732_01759.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	11	319	9.4e-89	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd18623	GH32_ScrB-like	8.84e-142	17	308	1	286	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
COG1621	SacC	2.30e-123	6	438	28	477	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
TIGR01322	scrB_fam	1.72e-121	6	422	13	444	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
pfam00251	Glyco_hydro_32N	7.18e-102	11	319	1	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.
smart00640	Glyco_32	2.76e-101	11	412	1	437	Glycosyl hydrolases family 32.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM70237.1	4.15e-150	6	422	5	413
CCO04388.1	1.95e-143	1	437	13	452
CBL20909.1	2.17e-123	7	437	29	463
QCU01937.1	9.87e-122	7	437	29	463
QNM06260.1	1.97e-121	6	422	28	458

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VCO_A	2.45e-72	9	422	28	459	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
7BWB_A	2.07e-56	6	421	48	460	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
6NU7_A	2.19e-55	6	421	32	462	Structureof sucrose-6-phosphate hydrolase from Lactobacillus gasseri [Lactobacillus gasseri 224-1],6NU8_A Structure of sucrose-6-phosphate hydrolase from Lactobacillus gasseri in complex with fructose [Lactobacillus gasseri 224-1]
7BWC_A	2.99e-55	6	421	48	460	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]
3PIG_A	4.73e-53	6	426	39	490	beta-fructofuranosidasefrom Bifidobacterium longum [Bifidobacterium longum],3PIG_B beta-fructofuranosidase from Bifidobacterium longum [Bifidobacterium longum],3PIJ_A beta-fructofuranosidase from Bifidobacterium longum - complex with fructose [Bifidobacterium longum],3PIJ_B beta-fructofuranosidase from Bifidobacterium longum - complex with fructose [Bifidobacterium longum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P16553	1.44e-89	6	422	23	449	Raffinose invertase OS=Escherichia coli OX=562 GN=rafD PE=3 SV=1
P40714	1.35e-83	10	422	28	450	Sucrose-6-phosphate hydrolase OS=Escherichia coli OX=562 GN=cscA PE=3 SV=1
P07819	2.00e-83	7	425	29	457	Sucrose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacA PE=3 SV=2
P27217	2.87e-79	11	422	31	439	Sucrose-6-phosphate hydrolase OS=Klebsiella pneumoniae OX=573 GN=scrB PE=1 SV=3
P37075	8.74e-78	11	422	31	439	Sucrose-6-phosphate hydrolase OS=Salmonella typhimurium OX=90371 GN=scrB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004732_01759.