CAZyme Information: MGYG000004733_02830

Basic Information

• Species: Blautia_A sp900548245
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia_A; Blautia_A sp900548245
• CAZyme ID: MGYG000004733_02830
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
534		57627.95	9.4649

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004733	3524332	Isolate	United States	North America

• Gene Location: Start: 103417; End: 105021 Strand: +

Full Sequence      

MALKGTTNEERIWNFCIGKGMSKCGAAGLMGNIYAESGLVPTNLQNSFEKKLGYTDAAYT
AAVDNGSYKNFVRDSAGYGLCQWTYWSRKQALLAFCQSKGTSIGDLEMQLEFMYKELSEN
YGTVISELRSATSVLQASNAVLLKYERPADQSSAVQRRRASYGQVYYDKFASKATKPEGG
KTMGYTNSSLVDCVVKSPNHSGRRTHSIDRLTPHCVVGQLSAESIGSCFTSSSVQASCNY
GIGKDGRVVLCVDEANRSWCSSSNANDQRAITIECASGMKEPYEMNNTVYEKLIKLCADI
CRRNGKTKVVWKGSKSASLAYEPKSNEMVLTAHRFFANKSCPGDWLYSRYSDLANRINAL
LGSGTTASGGNSNDSTNTSAPSKPNTNFPKVPFTVNVIVSDLNIRKAPNGDIVGKTGKGV
FTITSVKNGWGKLKSGAGWIYLANADYCTIGSSVSGTSSKPSTNVSKVPYKVRVDASDLR
IRSGAGTNYPTTGEYTGKGTFTIIEEKAGTGSTKGWGKLKSGAGWISLDYCVKL

Enzyme Prediction     

No EC number prediction in MGYG000004733_02830.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam18013	Phage_lysozyme2	3.71e-34	7	170	1	139	Phage tail lysozyme. This domain has a lysozyme like fold. It is found in the tail protein of various phages probably giving them the ability to degrade the host cell wall peptidoglycan layer.
pfam01510	Amidase_2	4.13e-18	208	344	2	121	N-acetylmuramoyl-L-alanine amidase. This family includes zinc amidases that have N-acetylmuramoyl-L-alanine amidase activity EC:3.5.1.28. This enzyme domain cleaves the amide bond between N-acetylmuramoyl and L-amino acids in bacterial cell walls (preferentially: D-lactyl-L-Ala). The structure is known for the bacteriophage T7 structure and shows that two of the conserved histidines are zinc binding.
cd06583	PGRP	4.98e-08	235	345	35	126	Peptidoglycan recognition proteins (PGRPs) are pattern recognition receptors that bind, and in certain cases, hydrolyze peptidoglycans (PGNs) of bacterial cell walls. PGRPs have been divided into three classes: short PGRPs (PGRP-S), that are small (20 kDa) extracellular proteins; intermediate PGRPs (PGRP-I) that are 40-45 kDa and are predicted to be transmembrane proteins; and long PGRPs (PGRP-L), up to 90 kDa, which may be either intracellular or transmembrane. Several structures of PGRPs are known in insects and mammals, some bound with substrates like Muramyl Tripeptide (MTP) or Tracheal Cytotoxin (TCT). The substrate binding site is conserved in PGRP-LCx, PGRP-LE, and PGRP-Ialpha proteins. This family includes Zn-dependent N-Acetylmuramoyl-L-alanine Amidase, EC:3.5.1.28. This enzyme cleaves the amide bond between N-acetylmuramoyl and L-amino acids, preferentially D-lactyl-L-Ala, in bacterial cell walls. The structure for the bacteriophage T7 lysozyme shows that two of the conserved histidines and a cysteine are zinc binding residues. Site-directed mutagenesis of T7 lysozyme indicates that two conserved residues, a Tyr and a Lys, are important for amidase activity.
PRK06347	PRK06347	7.70e-04	358	521	365	512	1,4-beta-N-acetylmuramoylhydrolase.
PRK06347	PRK06347	0.002	348	521	288	438	1,4-beta-N-acetylmuramoylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFB75734.1	1.32e-217	1	455	1	454
QUO22979.1	5.02e-215	1	450	1	449
ADB89215.1	3.55e-86	183	473	11	470
CBL18646.1	4.22e-86	183	534	3	505
QQQ98955.1	1.06e-50	385	534	387	539

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004733_02830.