CAZyme Information: MGYG000004734_00470

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; HGM11417
• CAZyme ID: MGYG000004734_00470
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
817	MGYG000004734_2|CGC1	91000.47	5.6987

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004734	2053744	MAG	China	Asia

• Gene Location: Start: 177247; End: 179700 Strand: -

Full Sequence      

MEIYGLTTEYAAEPLAVESRAPRFGWKWRAKGEFFQESYRVLVSENPTVQIGDCWDSGET
MSGESVGIRYAGVPLKPRTRYYWRVISHGIESPVAAFETALWESSLWLGRWIGMPMNFAG
HTLLLRTAFEIPVGKNVLRARAYVAGLGCHVAYLNGARAGAEVLGPKVSSYDKRVYYNTY
ALDVRPGTNVFGLELGYGWLGNRMALAQIFVDFADGSVLHLCTESGENWWAGCGAVTSNS
IYGGERYDARLERAGWCTPGYAPGWDRGWMYSVGVPPLSGKLCAQQSEGMTVVSRFPGRS
LGGDVFDIGQNISGWARIRVRGERGAKVRLRFAERLDESGRLNRLNLRSAANEDEYILKG
DGEEEWAPSFTWHGFQYVEAKIEGKAELLSLEGEHVRSGVGKIGDFTCSDETLNRLHELA
WRTESNNILGVLTDCPQRDERFGWLNDLTARIWQMANNFDYARFLPEFVRDITDAQKSDG
SIPDTAPHFVGGRPADPVSGYLILALACYAMYGDEDCLRENYEAFQSWLGCLSTHVGEEG
TLNSGVYGDWVPAAPFTKEGGECPFSAAAEPEFLSAAYFVWYHGMMERIARAIGREQDAK
DYAEKREQLLAAFRRKYGDARGQTQTSVMLTAGARTDAETAAKELAEDVAVHGYHTTCGN
QGYRHLLEWLGACGQAETAIALLKNPEYPGWGYMLACGATTVWERWEEDMKNLMHSYDHP
MFASYDSFLYRHVAGLIVSSDARGADRFVIAPKFPAGIASARASVETVRGRAAVEWRRKG
DEVTLTAEIPANTRAEFRLPVKAENKNGKFFFVFPIK

Enzyme Prediction     

No EC number prediction in MGYG000004734_00470.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	304	799	2e-132	0.9821428571428571
CBM67	111	269	3.7e-20	0.9034090909090909

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	3.22e-77	402	733	2	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.92e-39	135	293	1	171	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	5.38e-32	305	396	9	101	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	3.26e-16	738	806	2	70	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
COG3408	GDB1	0.007	479	617	318	461	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA22854.1	1.82e-165	1	800	32	852
QEC51112.1	1.80e-164	1	806	69	902
AHF90970.1	5.63e-158	9	804	14	849
VEH16339.1	4.11e-156	3	802	34	856
ABW01021.1	4.18e-146	1	805	5	844

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	4.56e-129	4	800	33	899	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	2.32e-103	83	810	268	1009	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	7.05e-82	1	806	2	853	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	1.01e-102	83	810	268	1009	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	3.37e-87	14	807	47	892	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
T2KPL4	2.47e-85	12	811	41	921	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
P9WF03	9.81e-74	14	800	43	879	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999979	0.000056	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004734_00470.