CAZyme Information: MGYG000004735_00410

Basic Information

• Species: UBA7160 sp900757145
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA7160; UBA7160 sp900757145
• CAZyme ID: MGYG000004735_00410
• CAZy Family: GH2
• CAZyme Description: Evolved beta-galactosidase subunit alpha

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1011	MGYG000004735_2|CGC1	117056.86	5.0015

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004735	3188924	MAG	Spain	Europe

• Gene Location: Start: 139978; End: 143013 Strand: +

Full Sequence      

MIVPRYYENLDVLHENTMSARAYYIPASKRMDDLAERREMSDRIQFLNGVWKFKYYDSIY
DVTEEFYRTDFDVSGYDTIKVPGVWQNAGYDCHQYTNIRYPFPFDPPYVPCDIPCGAYAY
DFTYSKDEKAGRALLNFEGVDSCFYVWLNGKYVGYSQVPHCTDEFDVTDVIRAGSNRIAV
LVLKWCDGSYLEDQDKFRMSGIFRDVYILKRPEQAIRDYRVATKTGKADSKVKIDVVFDG
EVDTKVTLEDMCGVVIAASAISKNGSIEFKVSNPVLWNTEDPYLYRLIFETEYETIVEYV
GFRTIEIIDKVIYFNGQKIKFRGVNRHDSDPVTGFTVSTDQLIADLRLMKQHNINAIRSS
HYPNVPYFYQLCDKYGFMVIDEADIEAHGPLMLYRKPDNDQNRLKLWSEEIADDPAWETS
IMDRVQLMVKRDKNRPSIVMWSMGNESAYGCNFEKALKWTKEFDASRLTQYESARYRNYD
VTYDYSNLDLYSRMYPSAAEIEDYLKEDASKPFLLVEYSHSMGNGPGDFEDYFQLIQSDD
RMCGGFVWEWCDHAVCKGVAKNGKQMYFYGGDHGEDLHDGNFCMDGLVYPDRRVHTGLLE
HKNVYRPARVVNYNAAGKKLTIHNYMDFDDLRDYINAQYEVTCDGITVDRGKLTLPSVAP
HCDGETELDFRIPEKGRVFLKVRYTLKKKMKLIPEDHELGFDEIAVPNGDSRNQNALKWL
RYEPVQQELEVSQNDAQVIVKSGTFTYIYSKKSGMFESLTYAGQEYLERPMELNIWRAPT
DNDMHLKLEWKKAYYDRACVRAYCTDICQSKDGVTITARTSMAAASVQKILDAVIIWNID
AGGAVTSSIHAVKNEEFPDLPRFGLRLFLNRKLVHVSYFGMGPHESYRDKHRSTSHGLYR
ADVSEMHEDYIRPQENGSHYDCDYIEITDGEFGITAVSKQPFSFNVSVYTQEELERATHN
YELQVSDSTVLCLDYAQNGIGSHSCGPVLMDQYRFCETVFDFFIKLIPYQM

Enzyme Prediction     

EC	3.2.1.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	33	894	7.8e-208	0.9720744680851063

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09525	lacZ	0.0	5	981	15	998	beta-galactosidase.
PRK10340	ebgA	0.0	7	1010	4	1001	cryptic beta-D-galactosidase subunit alpha; Reviewed
COG3250	LacZ	1.22e-142	39	889	7	799	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam02836	Glyco_hydro_2_C	6.45e-93	305	607	1	299	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
smart01038	Bgal_small_N	1.72e-89	741	994	1	260	Beta galactosidase small chain. This domain comprises the small chain of dimeric beta-galactosidases EC:3.2.1.23. This domain is also found in single chain beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUI95749.1	0.0	1	1009	1	1005
AYA98461.1	0.0	1	1009	1	1005
ACR72837.1	0.0	1	1009	8	1017
QCU02777.1	0.0	1	1009	1	1009
QUF79621.1	0.0	1	1009	1	1009

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SD0_A	5.71e-174	3	1006	1	980	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
6S6Z_A	7.81e-174	4	1006	1	979	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6ETZ_A	1.01e-153	47	1006	39	985	Cold-adaptedbeta-D-galactosidase from Arthrobacter sp. 32cB [Arthrobacter sp. 32cB],6H1P_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cB - data collected at room temperature [Arthrobacter sp. 32cB]
6SEB_A	1.72e-153	47	1006	60	1006	Cold-adaptedbeta-D-galactosidase from Arthrobacter sp. 32cB in complex with IPTG [Arthrobacter sp. 32cB],6SEC_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cBon complex with ONPG [Arthrobacter sp. 32cB],6SED_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cB in complex with galactose [Arthrobacter sp. 32cB]
3BGA_A	4.73e-153	39	993	43	985	Crystalstructure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],3BGA_B Crystal structure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P70753	6.72e-296	1	1007	1	998	Beta-galactosidase OS=Actinobacillus pleuropneumoniae OX=715 GN=lacZ PE=3 SV=1
O33815	5.10e-241	1	1006	1	991	Beta-galactosidase OS=Staphylococcus xylosus OX=1288 GN=lacZ PE=3 SV=1
Q56307	3.13e-173	3	1006	1	980	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
P06864	6.73e-171	7	1008	4	999	Evolved beta-galactosidase subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=ebgA PE=1 SV=4
O52847	1.96e-166	4	981	18	1004	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004735_00410.