CAZyme Information: MGYG000004735_02092

Basic Information

• Species: UBA7160 sp900757145
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA7160; UBA7160 sp900757145
• CAZyme ID: MGYG000004735_02092
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
479	MGYG000004735_17|CGC2	56203.01	4.8402

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004735	3188924	MAG	Spain	Europe

• Gene Location: Start: 50364; End: 51803 Strand: +

Full Sequence      

MMNKADYERQKPDFGYMRESVKKDANRLHFHLMPPTGWMNDPNGICQMNGVYHIYFQYTP
FLAGWGTKLWGHYTTKDWLHFEEQEPFLFPDCVWDRDGVYSGSAFVKDGKIHYFYTGNVK
LFDKEYDYILEGREQNTIHFTSEDGIQADKKQLVMTNEDYPSDMSKHVRDPKVFEANGKY
YMVQGARNVHSEGCALLFESEDLEHWEYFDRITPDEPFGYMWECPDLFEVDGQKVLLACV
QGLDAKEHQYQNVYQCGYFPAQIDLEKREYHLGEYRELDKGFDIYAAQTFKDEKGRRILI
GWMGIPDADYDNDATVKYNWIHAMTMPRELRFQDGRLIQQPLDEMKALRKNERQTDIQSF
GKWTTSDCCFEMEVQFQEPQERMALKLRDDVRVSYEAHVLSLELGKSGHGRTKRTVYLES
LRSFTVFSDTSSLEIFINGGEEVMTTRVYSEKLTQTVEFAESTASGSVRVYELGSYSYC

Enzyme Prediction     

No EC number prediction in MGYG000004735_02092.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	31	341	1.6e-91	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd18623	GH32_ScrB-like	1.74e-159	37	334	1	289	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
TIGR01322	scrB_fam	7.92e-145	17	449	4	443	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG1621	SacC	6.44e-131	18	473	20	480	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
pfam00251	Glyco_hydro_32N	5.51e-113	31	341	1	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.
smart00640	Glyco_32	4.37e-103	31	440	1	437	Glycosyl hydrolases family 32.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SOB72997.1	4.07e-240	2	476	1	495
AXQ77793.1	5.58e-198	1	477	1	475
BAK29386.1	1.12e-197	1	477	1	475
QIX73692.1	1.12e-197	1	477	1	475
SQI07836.1	1.12e-197	1	477	1	475

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6NU7_A	2.83e-66	27	463	33	476	Structureof sucrose-6-phosphate hydrolase from Lactobacillus gasseri [Lactobacillus gasseri 224-1],6NU8_A Structure of sucrose-6-phosphate hydrolase from Lactobacillus gasseri in complex with fructose [Lactobacillus gasseri 224-1]
7VCO_A	6.61e-63	30	473	29	480	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
7BWB_A	3.68e-60	27	451	49	462	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
7BWC_A	5.34e-59	27	451	49	462	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]
1UYP_A	1.07e-48	29	438	5	395	Thethree-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_B The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_C The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_D The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_E The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_F The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07819	3.13e-113	21	449	23	453	Sucrose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacA PE=3 SV=2
Q05936	5.79e-89	17	466	24	478	Sucrose-6-phosphate hydrolase OS=Staphylococcus xylosus OX=1288 GN=scrB PE=3 SV=1
P13394	1.39e-83	13	455	23	459	Sucrose-6-phosphate hydrolase OS=Vibrio alginolyticus OX=663 GN=scrB PE=2 SV=1
P27217	2.83e-81	24	449	24	438	Sucrose-6-phosphate hydrolase OS=Klebsiella pneumoniae OX=573 GN=scrB PE=1 SV=3
P37075	3.68e-78	24	449	24	438	Sucrose-6-phosphate hydrolase OS=Salmonella typhimurium OX=90371 GN=scrB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999286	0.000690	0.000030	0.000009	0.000003	0.000013

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004735_02092.