CAZyme Information: MGYG000004739_00354

Basic Information

• Species: Actinomyces sp000220835
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Actinomyces; Actinomyces sp000220835
• CAZyme ID: MGYG000004739_00354
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
315		31949.35	3.8276

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004739	2692200	MAG	China	Asia

• Gene Location: Start: 22377; End: 23324 Strand: +

Full Sequence      

MNRTTGILIAAGLALMSILLLPVSVLLLVDTGDSGGEGGGGNKSVANVPSEYVDVITRAG
SVCEAITPALLAAQIEQESGWQPQVGSSAGAQGIAQFMPATWASSGMDGDGDGVADINNP
IDAIWSQGNYMCGLAGQVQGYIDQGAASGDVVSLTLAAYNAGAGAVEQYGGVPPYGETTH
YVEVITANASKYEGSTGGGGGDRGQQVLASARARIGMPYVWGAASDSVGYDCSGLVMVAY
SEAGVELQHSSGSQCSSGTQVSKEEAQPGDLVCWSGHVAIWAGNDTIVEAPTEGVPVRET
AVYTMDGGPYFVHLD

Enzyme Prediction     

No EC number prediction in MGYG000004739_00354.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	65	192	3e-28	0.8222222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13399	Slt35-like	3.81e-34	66	165	3	97	Slt35-like lytic transglycosylase. Lytic transglycosylase similar to Escherichia coli lytic transglycosylase Slt35 and Pseudomonas aeruginosa Sltb1. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
cd00254	LT-like	1.17e-26	68	189	1	110	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam00877	NLPC_P60	1.88e-18	216	299	1	90	NlpC/P60 family. The function of this domain is unknown. It is found in several lipoproteins.
COG0791	Spr	5.21e-18	205	300	76	180	Cell wall-associated hydrolase, NlpC family [Cell wall/membrane/envelope biogenesis].
cd13401	Slt70-like	2.17e-17	49	193	3	150	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEI18427.1	3.08e-126	41	315	35	308
VEG28534.1	2.18e-113	48	314	271	534
CED91304.1	4.04e-90	20	312	12	319
VEG29992.1	9.42e-85	15	312	1	314
AYD89184.1	1.95e-67	10	303	5	307

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XIV_A	9.27e-16	205	312	81	204	Structureof Rv1477, hypothetical invasion protein of Mycobacterium tuberculosis [Mycobacterium tuberculosis H37Rv]
3PBC_A	1.02e-15	205	312	86	209	ChainA, Invasion Protein [Mycobacterium tuberculosis]
3NE0_A	1.02e-15	205	312	86	209	Structureand functional regulation of RipA, a mycobacterial enzyme essential for daughter cell separation [Mycobacterium tuberculosis H37Rv]
3S0Q_A	1.79e-14	205	312	87	210	ChainA, INVASION PROTEIN [Mycobacterium tuberculosis]
4Q4T_A	4.98e-14	205	312	344	467	Structureof the Resuscitation Promoting Factor Interacting protein RipA mutated at E444 [Mycobacterium tuberculosis H37Rv]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WHU3	6.85e-16	198	311	268	380	Probable endopeptidase Rv2190c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2190c PE=3 SV=1
P9WHU2	6.85e-16	198	311	268	380	Probable endopeptidase MT2245 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT2245 PE=3 SV=1
P67474	6.85e-16	198	311	268	380	Probable endopeptidase Mb2213c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=BQ2027_MB2213C PE=3 SV=1
O31976	1.67e-15	37	191	1407	1543	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	1.67e-15	37	191	1407	1543	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.599693	0.394246	0.001128	0.001245	0.000754	0.002935

TMHMM  Annotations     

start	end
7	29