CAZyme Information: MGYG000004739_01387

Basic Information

• Species: Actinomyces sp000220835
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Actinomyces; Actinomyces sp000220835
• CAZyme ID: MGYG000004739_01387
• CAZy Family: GT39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
658		72692.66	6.7812

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004739	2692200	MAG	China	Asia

• Gene Location: Start: 117; End: 2093 Strand: -

Full Sequence      

MISRSVPSPDDASGASASDPRPADDPVEGDPAAPAQETQSSTQWADPRGTGPFDTSGPYE
ASPYGPLRTAVQQEDDVRSARSTRSEDQLRSILGLDPVGWVLPVSVRLNGWIVTAVTGVI
AVLTRFIGLGHPHSLMFDEIYYVKDAYALWHNGYESTWSKDSDPLFAHGDFSGLTSEPSF
VVHPQLGKWIIGAGMELFGADSSFGWRFMPALAGVATVVLLTRLTMRLTRSPLLAGLAGL
LLAIDGTAITESRIGLLDIFIGFFATLTVYFVVRDREWSRARLARDLSGTAIGHLAPRAH
LRPWLLAAGIAAGLTCSIKWSGLYLLAAVGVLVVVWDTLALQRVEARAWLLEGLIARSFG
DFLRLVPTALVVYVAGWWSWFLHADAYKHGWAASERLTNGTVTRSWLPDSLNDLLEYHQV
AYGFHVKLNSPHQYMSKPIGWLVQWRPTSFYWPSAEELGGRDCGSDRCVAAITSIGNIPI
WWSALVALVFAVAVLAVKNRDWRVWVALVGYAGLYLPWFLYGKRTIFTFYTVAFVPFVVL
VLVLSLGSAMGALAPVPGSREAEYEDRMLRLGYLGEDRPHPRGALAAYLGFGTQPTRLRL
SQEWTGVPAWRLHVEGVVLTACVVLASVVFAILWWPIWTGEPVPYDFWRWHMILPSWI

Enzyme Prediction     

No EC number prediction in MGYG000004739_01387.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	119	381	5.5e-68	0.9820627802690582

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1928	PMT1	1.90e-18	119	324	32	214	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
pfam02366	PMT	3.28e-13	118	324	4	187	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG4346	COG4346	3.97e-12	183	536	136	399	Predicted membrane-bound dolichyl-phosphate-mannose-protein mannosyltransferase [Posttranslational modification, protein turnover, chaperones].
pfam16192	PMT_4TMC	5.06e-07	413	527	2	121	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
pfam13231	PMT_2	6.13e-04	182	314	1	110	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEG29597.1	9.98e-303	84	658	89	662
CED92488.1	6.19e-298	8	658	17	648
QHO90411.1	2.26e-293	84	658	83	658
ALD00763.1	1.81e-287	82	658	24	599
QPL05649.1	1.85e-286	84	658	61	634

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L8F4Z2	1.14e-58	107	550	34	461	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycolicibacterium smegmatis (strain MKD8) OX=1214915 GN=pmt PE=3 SV=1
P9WN04	8.71e-56	107	550	40	467	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pmt PE=3 SV=2
P9WN05	8.71e-56	107	550	40	467	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pmt PE=1 SV=2
Q8NRZ6	1.36e-43	115	551	39	466	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=pmt PE=3 SV=1
Q5A688	7.74e-07	180	375	137	347	Dolichyl-phosphate-mannose--protein mannosyltransferase 6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT6 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.991012	0.008946	0.000035	0.000015	0.000009	0.000013

TMHMM  Annotations     

start	end
110	129
204	226
233	250
254	273
320	342
362	384
475	497
502	521
526	548
616	638