CAZyme Information: MGYG000004739_01485

Basic Information

• Species: Actinomyces sp000220835
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Actinomyces; Actinomyces sp000220835
• CAZyme ID: MGYG000004739_01485
• CAZy Family: GT4
• CAZyme Description: Glycosyltransferase Gtf1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
391	MGYG000004739_55|CGC1	39824.52	8.5505

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004739	2692200	MAG	China	Asia

• Gene Location: Start: 9687; End: 10862 Strand: -

Full Sequence      

MTSGITTAPTSPTCARRWRVLEVSGSAAGGVRAHLGDCARLLARAGHDVLVEAPAAVLAG
LDLGGARGRALEIGTAPAAGDAAAVARLRLLGRRADVVHAHGLRAGAAAALALGRRRDSR
TRLVVTLHNLTVGGWITRAVGARLERLIAARADLVLAVSPDLAERALECGAARVEIAVVP
APRRPGTDSPPRASSVESAWRGGGGRVLTAARLAPQKGIDLLLEAAALLQERVNAGGLGG
VVWALAGEGPQAPAVQERVRASGLPVRLLGRREDIAVLLEEADVVVQTSLWEGQPLIIQE
ALRAGAAVVATDVGGTALTARGGAVLVEPRARAVADAIAALLTDDSALSDARGRACAAAN
DLPTDDDLADQLAGILPPPDRASRVDAADGR

Enzyme Prediction     

No EC number prediction in MGYG000004739_01485.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	207	346	1.2e-24	0.88125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	6.08e-27	29	355	14	343	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03811	GT4_GT28_WabH-like	3.39e-26	19	361	1	343	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
COG0438	RfaB	5.21e-24	29	358	15	355	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03819	GT4_WavL-like	7.43e-23	29	315	11	289	Vibrio cholerae WavL and similar sequences. This family is most closely related to the GT4 family of glycosyltransferases. WavL in Vibrio cholerae has been shown to be involved in the biosynthesis of the lipopolysaccharide core.
cd03807	GT4_WbnK-like	8.48e-20	93	355	78	339	Shigella dysenteriae WbnK and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. WbnK in Shigella dysenteriae has been shown to be involved in the type 7 O-antigen biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALC99411.1	5.12e-148	16	379	16	377
AMD87784.1	7.04e-148	12	378	10	371
QLF53644.1	9.07e-142	15	372	18	377
VEG26675.1	1.49e-140	17	389	41	416
QQC40440.1	4.22e-140	17	372	20	377

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000023	0.000032	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004739_01485.