CAZyme Information: MGYG000004739_01621

Basic Information

• Species: Actinomyces sp000220835
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Actinomyces; Actinomyces sp000220835
• CAZyme ID: MGYG000004739_01621
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
339	MGYG000004739_65|CGC1	35931.37	8.2724

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004739	2692200	MAG	China	Asia

• Gene Location: Start: 12088; End: 13107 Strand: -

Full Sequence      

MSEQHESDGVVGRRGSAPVPRGRADTPDAPHLTVAVLTYRRNAYLAELLPVLLTQVDGVR
ERVRPRVLVVDNDPRAGAAEVVSGAAGEPGRISPSYVHEAEPGIVAGRNRALAECADEDL
LVFIDDDEMPRSGWLAALLAAWREHGCAAVTGPTPPAYEKVPDDWVTASGAFDSWQADDG
ARVTSADTGNLLLDLAVVRGLGLRFDPRYGLTGGEDSLFTRSLSLAGATIRFATGAVVDK
RVAPERATRDWVLRRSFRAGSSWARVRVDTSTGSRLPARLGYAAKGLARAGRDAVRAQAA
RGRGDTAARAVHEVSCRGGLGMVVGAFGGRVLEYGRSAS

Enzyme Prediction     

No EC number prediction in MGYG000004739_01621.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00761	Glyco_tranf_GTA_type	7.31e-11	34	153	1	114	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
pfam00535	Glycos_transf_2	1.48e-10	33	174	1	134	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG1216	GT2	2.49e-10	32	304	5	284	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
COG1215	BcsA	4.73e-08	18	265	42	282	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd04186	GT_2_like_c	4.77e-08	34	238	1	162	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEG29656.1	1.09e-141	30	339	12	321
ALD00492.1	4.58e-140	32	338	1	306
VEG73651.1	1.09e-132	16	338	8	339
AYD90410.1	3.69e-132	30	336	4	335
QCT34029.1	9.23e-130	31	336	2	336

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P33695	1.08e-26	31	275	7	246	Succinoglycan biosynthesis protein ExoM OS=Rhizobium meliloti (strain 1021) OX=266834 GN=exoM PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004739_01621.