CAZyme Information: MGYG000004739_02161

Basic Information

• Species: Actinomyces sp000220835
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Actinomyces; Actinomyces sp000220835
• CAZyme ID: MGYG000004739_02161
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
501	MGYG000004739_127|CGC1	55211.3	8.7535

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004739	2692200	MAG	China	Asia

• Gene Location: Start: 1916; End: 3421 Strand: -

Full Sequence      

MTLTVQRAGSLTLPTPVEVRGDRDQLIGLSCFGLSAAAPEYSARGTLVRWQRVLLAGATA
VVLAGLVLRPRVAGIVLVAVATLAYVTALTYRLILFRLGARGGRMVAVTDEEARAVPDAA
LPVYTVLVPVFHEPLLADLVERLETLDYPRHLLDIQLLLEADDDETAEAAKTLQPRDHLG
IVYVPSREPRTKPKACNYGFLTSEGQMCTIYDAEDAPDPLQLRRAVVAMRRLGPDYACVQ
ARLGFYNSDQNLLTRWFALDYGSWFANMLPGLVALGAPVPLGGTSNHFRADVLRATGAWD
PWNVTEDADLGLRLHRAGYKVGVLDSVTREEANSDAINWVRQRSRWYKGYVQTFLVHARR
PRLVTGQLGWRGIVGLVVFIAGTPLLSALNGFFWALTVMWFTSHDPTLAALFPSVVYYLG
MICLVLGNLAVLYMGVFTARQMERPDLLLAAFLMPLYWALMWLAALKAVIQLVTAPSYWE
KTAHGLNRARVPAAPMAGRVA

Enzyme Prediction     

No EC number prediction in MGYG000004739_02161.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	124	348	6e-27	0.9782608695652174

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06427	CESA_like_2	5.57e-136	122	361	1	241	CESA_like_2 is a member of the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, Glucan Biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of glucan.
COG1215	BcsA	2.59e-47	116	484	48	424	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	3.14e-36	126	307	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
cd06437	CESA_CaSu_A2	3.48e-24	122	349	1	231	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.
cd06421	CESA_CelA_like	1.93e-23	122	354	1	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYW77970.1	2.89e-272	11	488	12	489
VEH89164.1	6.62e-272	11	488	13	490
BAW93041.1	4.47e-267	11	501	15	505
ARD42749.1	9.93e-264	13	501	17	505
QKD79682.1	5.72e-263	11	501	15	505

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P74165	5.11e-14	133	386	120	370	Beta-monoglucosyldiacylglycerol synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1377 PE=1 SV=1
P96587	7.12e-14	121	349	48	279	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
Q9LJP4	3.54e-11	109	354	186	439	Xyloglucan glycosyltransferase 4 OS=Arabidopsis thaliana OX=3702 GN=CSLC4 PE=1 SV=1
Q7PC76	2.73e-10	119	354	81	324	Glucomannan 4-beta-mannosyltransferase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=CSLA1 PE=1 SV=1
Q7PC69	4.61e-10	146	354	286	501	Probable xyloglucan glycosyltransferase 3 OS=Oryza sativa subsp. japonica OX=39947 GN=CSLC3 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.998959	0.001029	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
53	70
74	96
372	394
414	436
448	470