CAZyme Information: MGYG000004739_02200

Basic Information

• Species: Actinomyces sp000220835
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Actinomyces; Actinomyces sp000220835
• CAZyme ID: MGYG000004739_02200
• CAZy Family: GH77
• CAZyme Description: 4-alpha-glucanotransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
718	MGYG000004739_134|CGC1	79306.2	4.5905

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004739	2692200	MAG	China	Asia

• Gene Location: Start: 1795; End: 3951 Strand: +

Full Sequence      

MTESIATSEPAGERLKQLAEAHGVSTEYWDYHGNLAAPSRATLVAVLAALGVEAGTDEEI
ETSLAQVEITPWRRTLPPSVVARAGEEVRVPVHVPDGAGVRVHVDLEDGSRRELPQTDDW
TLPHDVDGVLTGRATFALPADLPLGWHALVADIDASPACEAHSATTPLAVTPDRLELPAS
LGERGWGVMAQLYSVRSRGSWGIGDADDLTELASLLGDEGADFLLINPLHASEPAGTMTP
SPYLPVTRRFVNPIYIRPEAIAEVARLSGPRRSLVQWAFEEVSETDLSADPIDRDAVWKA
KREALEVIFAAGRSRARQRDFERFRAEQGEGLERFALWCALSEKYGELQDWPETLRDASN
AFVANEARTLTERIDFYAWMQWIVDEQLGRAQSEARASGMGLGIMGDLAVGVHPRGADAW
SDPESFAAGIEAGAPPDMYNQLGQNWSQPPWSPTRLAESAYAPLRDMMRTVLRHAGALRM
DHIIGLFRLWWIPRGMGADQGAYVRYDHEAMVGVVLLEAYRAGAVIIGEDLGTVEPWVRD
YLASRGVLGTSVLWFEKQQDGWPLQPDAYRYLSLSTVNTHDLPPTAGYLADEHVTLRERL
GLLTEPVEQVRAEARVERERMLTRLREHGLLRNDPSEREIVEALYRYIVRTPSALIGIAL
VDGVGERRTQNQPGTDQEYPNWKIPLADGSGEVVLVEDLPGNVRLSSLLAAVRDELRH

Enzyme Prediction     

EC	2.4.1.25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH77	191	694	1.8e-144	0.9595141700404858

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14507	PRK14507	6.99e-165	15	715	8	720	malto-oligosyltrehalose synthase.
pfam02446	Glyco_hydro_77	4.23e-157	191	687	2	458	4-alpha-glucanotransferase. These enzymes EC:2.4.1.25 transfer a segment of a (1,4)-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or (1,4)-alpha-D-glucan.
COG1640	MalQ	2.23e-155	186	699	14	505	4-alpha-glucanotransferase [Carbohydrate transport and metabolism].
PRK11052	malQ	7.15e-142	14	682	5	661	4-alpha-glucanotransferase; Provisional
PRK14510	PRK14510	6.55e-111	133	715	672	1217	bifunctional glycogen debranching protein GlgX/4-alpha-glucanotransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CED89964.1	0.0	1	718	1	718
QHO90593.1	0.0	1	717	1	718
QQM66852.1	0.0	1	716	1	716
BDA63441.1	0.0	1	716	1	716
VEG74784.1	0.0	1	716	1	716

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5B68_A	1.02e-206	15	718	7	709	Crystalstructure of apo amylomaltase from Corynebacterium glutamicum [Corynebacterium glutamicum],5JJH_A Crystal structure of amylomaltase from Corynebacterium glutamicum [Corynebacterium glutamicum]
4S3P_A	1.97e-90	13	687	4	664	AmylomaltaseMalQ from Escherichia coli, apo structure [Escherichia coli K-12],4S3P_B Amylomaltase MalQ from Escherichia coli, apo structure [Escherichia coli K-12],4S3Q_A Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12],4S3Q_B Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12],4S3Q_C Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12]
4S3R_A	1.16e-85	13	687	4	664	AmylomaltaseMalQ from Escherichia coli in complex with the pseudo-heptasaccharide acarviosine-glucose-acarbose [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WK22	4.42e-242	15	713	8	714	4-alpha-glucanotransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=malQ PE=3 SV=1
P9WK23	4.42e-242	15	713	8	714	4-alpha-glucanotransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=malQ PE=1 SV=1
P65337	4.42e-242	15	713	8	714	4-alpha-glucanotransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=malQ PE=3 SV=1
P15977	1.03e-89	13	687	4	664	4-alpha-glucanotransferase OS=Escherichia coli (strain K12) OX=83333 GN=malQ PE=1 SV=2
P45176	1.32e-84	13	687	8	674	4-alpha-glucanotransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=malQ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000009	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004739_02200.