CAZyme Information: MGYG000004740_00458

Basic Information

• Species: Eubacterium_I sp900557275
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eubacterium_I; Eubacterium_I sp900557275
• CAZyme ID: MGYG000004740_00458
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
246	MGYG000004740_3|CGC1	29098.33	7.7308

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004740	2494225	MAG	China	Asia

• Gene Location: Start: 132496; End: 133236 Strand: -

Full Sequence      

MIPKIIHYCWFGSDKSGKIRRQIESWKKLLPDYEIREWNEQNFDVYSLPYTSAAYRAGKY
AFVSDVARVHALFHYGGIYLDTDVKVYQNFDSILSHRCVIGFEEELYVATSFMACEPKHP
LMKQFLLLYENLAFYDENGEPIPGTNVEKLTRMLEKRGLQRKDEYQELSDGITVYPQEYF
SPYDYANCLHHNTERTICEHLFAVSWLPGNVKIRKGIKQVAGPLLGKEKMDWTRKKLEKF
REYMNR

Enzyme Prediction     

No EC number prediction in MGYG000004740_00458.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	20	95	9.8e-22	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	1.38e-22	1	145	81	226	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	1.75e-13	20	99	5	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	6.54e-06	1	129	45	191	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	0.004	30	83	145	193	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBP42009.1	1.73e-83	2	237	8	243
QWG57254.1	8.90e-74	2	239	8	246
QWG51644.1	8.90e-74	2	239	8	246
QWH24275.1	8.90e-74	2	239	8	246
QWG74950.1	8.90e-74	2	239	8	246

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9UT67	6.34e-09	1	132	81	213	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
O14084	4.74e-08	2	124	64	194	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
Q10323	7.10e-08	2	134	57	193	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
P38287	1.34e-07	1	138	61	199	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
P33300	1.82e-07	1	137	54	191	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004740_00458.