CAZyme Information: MGYG000004740_00688

Basic Information

• Species: Eubacterium_I sp900557275
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eubacterium_I; Eubacterium_I sp900557275
• CAZyme ID: MGYG000004740_00688
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
490	MGYG000004740_5|CGC1	56870.46	7.0985

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004740	2494225	MAG	China	Asia

• Gene Location: Start: 91703; End: 93175 Strand: +

Full Sequence      

MEQATRITNWIMLGILIFCFAYQAYYFMLICWKKWEPWKRLQKALGKDTEDVYKIATSND
VGDCQELYGKDQLLEKPCKRGSLKKLEVAKQEGSADLKNDIVVSHQDISGETMHRFAILV
AARNEESVIGQLLESIHLQEYPADFIDTYIVADNCDDDTAEVARENGAIVYERFNKIQVG
KGYALKYLLDQMKEEGKDRDYDGYFIFDADNLLEKDYVKEMDRTFRQGYRIITSYRNTKN
FGSNWLTSGYGLWFLHEAQWLNKARMLQGTSCAVSGTGFFFSREILEQMGGWHYFLLTED
IEFTISQILQGETIGYCERAVFYDEQPENFVASWHQRARWVKGYQQVFSKYGQRIWNGIT
RERRFACFDMTMSIWPAFVLMIASVFINIGLVAVGLATDRDLSFVWYNVGMNLLKTYVAM
MGLGVYTLLSEWKMIHASTTKKLMSIVTFPIFMYTFAPIAVVALSRKVEWKPIKHSCTVR
MSQLRSQVKS

Enzyme Prediction     

No EC number prediction in MGYG000004740_00688.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	115	342	1.4e-28	0.9869565217391304

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06438	EpsO_like	2.00e-80	118	303	1	183	EpsO protein participates in the methanolan synthesis. The Methylobacillus sp EpsO protein is predicted to participate in the methanolan synthesis. Methanolan is an exopolysaccharide (EPS), composed of glucose, mannose and galactose. A 21 genes cluster was predicted to participate in the methanolan synthesis. Gene disruption analysis revealed that EpsO is one of the glycosyltransferase enzymes involved in the synthesis of repeating sugar units onto the lipid carrier.
COG1215	BcsA	3.90e-37	117	464	57	405	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	2.32e-33	118	300	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
pfam13641	Glyco_tranf_2_3	3.67e-29	115	343	3	230	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
cd06427	CESA_like_2	7.38e-21	115	346	2	232	CESA_like_2 is a member of the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, Glucan Biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALC88354.1	5.30e-137	105	485	34	420
QFG01222.1	4.40e-134	89	485	22	413
QVY61531.1	7.49e-133	113	485	50	425
QSO45625.1	1.45e-132	115	485	52	424
BCI61275.1	2.81e-132	113	485	45	423

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P74165	1.57e-17	107	351	101	343	Beta-monoglucosyldiacylglycerol synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1377 PE=1 SV=1
P96587	3.63e-17	115	351	50	287	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
Q3MB01	1.13e-15	117	385	109	373	Beta-monoglucosyldiacylglycerol synthase OS=Trichormus variabilis (strain ATCC 29413 / PCC 7937) OX=240292 GN=Ava_2217 PE=1 SV=1
Q8YMK0	1.13e-15	117	385	109	373	Beta-monoglucosyldiacylglycerol synthase OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=all4933 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000092	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	29
374	396
409	428
443	465