CAZyme Information: MGYG000004743_00308

Basic Information

• Species: HGM10873 sp900753645
• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; HGM10873; HGM10873 sp900753645
• CAZyme ID: MGYG000004743_00308
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 2D

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
396		43957.39	4.7314

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004743	730958	MAG	Denmark	Europe

• Gene Location: Start: 18; End: 1208 Strand: +

Full Sequence      

MYYQDAVIEELKSITSIPSSLLQTGGLKIYTNLDLKAQEAIETSIKQTIDSDIQVASIIM
DPNTGAVLGLVGGTDYSKSQFNRALSVNRSVGSTIKPFLYYAALENNFTASTTFTSERTT
FVFSENQTYSPTNYGDQYPNKEISLASAIATSDNIYAVKTHLFLGSDVLVDMMKRVGITT
KLDSIPSLALGSQPISLIEMTAAYSMLANEGYKVKPHFIKRVEDIHGNVLYEYKDNKEAV
LNKSITFILNELLSNTSNPKYISYTYPTSYVISSKLTRKYAIKTGTTEYDHLVFGYNKDV
VVSVWSGYDDNRTLSVGDATNNKNLWADITEKYLDGKGDNWYSMPNNVVGVLVDPITGQL
ATEETKNSTIQYYLKGTEPSNDYNLDDVVPTIKPES

Enzyme Prediction     

No EC number prediction in MGYG000004743_00308.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02074	PBP_1a_fam	2.68e-89	2	334	200	529	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	1.59e-83	2	334	274	597	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	1.95e-63	11	383	384	768	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
PRK11636	mrcA	5.45e-37	52	392	424	840	penicillin-binding protein 1a; Provisional
COG0768	FtsI	4.95e-29	26	308	238	551	Cell division protein FtsI/penicillin-binding protein 2 [Cell cycle control, cell division, chromosome partitioning, Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNK49558.1	3.76e-107	2	379	272	653
QYF83258.1	3.76e-107	2	379	272	653
AKS39661.1	2.52e-106	2	386	272	658
QSB49256.1	2.52e-106	2	386	272	659
QNU35779.1	2.52e-106	2	386	272	659

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7U4H_A	1.36e-28	54	380	471	808	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
4OON_A	4.11e-28	54	379	395	768	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
2JCH_A	1.16e-26	22	359	55	406	Structuraland mechanistic basis of penicillin binding protein inhibition by lactivicins [Streptococcus pneumoniae R6]
2FFF_B	1.47e-26	22	359	47	398	OpenForm of a Class A Transpeptidase Domain [Streptococcus pneumoniae]
2BG1_A	1.53e-26	22	359	86	437	Activesite restructuring regulates ligand recognition in classA Penicillin-binding proteins (PBPs) [Streptococcus pneumoniae R6],2XD5_A Structural insights into the catalytic mechanism and the role of Streptococcus pneumoniae PBP1b [Streptococcus pneumoniae R6],2XD5_B Structural insights into the catalytic mechanism and the role of Streptococcus pneumoniae PBP1b [Streptococcus pneumoniae R6]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P70997	4.61e-95	2	381	272	655	Penicillin-binding protein 2D OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpG PE=2 SV=3
O66874	5.21e-30	52	379	391	712	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1
Q92G78	6.23e-29	34	396	398	786	Penicillin-binding protein 1A OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) OX=272944 GN=mrcA PE=3 SV=1
Q9KNU5	8.66e-29	36	380	414	804	Penicillin-binding protein 1A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=mrcA PE=3 SV=2
Q68VU2	1.13e-28	52	396	416	781	Penicillin-binding protein 1A OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) OX=257363 GN=mrcA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004743_00308.