CAZyme Information: MGYG000004744_01479

Basic Information

• Species: Megamonas sp900556715
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Selenomonadales; Selenomonadaceae; Megamonas; Megamonas sp900556715
• CAZyme ID: MGYG000004744_01479
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
348	MGYG000004744_87|CGC1	41056.09	5.7201

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004744	2057636	MAG	Denmark	Europe

• Gene Location: Start: 1158; End: 2204 Strand: -

Full Sequence      

MHSYKKIIYITLGIYMMMISMCFASQIDNLSKESSEKINLVWQPVIDEDNDLSKIDKIQG
VNVVSPSWFVIDSDQGHIQNKTNINYLRDIKTKGYKIWPLIHNNFDAEMTHKWLNDEKAK
DYIIRQLIFYAHRYDIEGYNFDLENIYDEDKDKLTQFMQEVTEALHQDNIVVSMDITVSS
EMQNWSKCYDRKALGECVDYLILMAYDEHGRLSETSGSVASLNWVENGIVDLVEQVPSEK
IILGIPLYMRLWEEDYQGNVSAKKLTMEEANKLMKEKDKYPIWLKNEGQIYFAYRENGKI
YRVWKEDVNSLRLKVDLVKKYKLAGVASWRKGFETKDIWPMINKRLQK

Enzyme Prediction     

No EC number prediction in MGYG000004744_01479.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	68	336	6.8e-37	0.7905405405405406

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	2.49e-85	60	342	25	313	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	5.50e-53	62	346	128	422	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
cd06549	GH18_trifunctional	1.84e-29	56	339	19	298	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.
smart00636	Glyco_18	6.35e-25	48	329	19	329	Glyco_18 domain.
pfam00704	Glyco_hydro_18	1.76e-20	115	329	85	302	Glycosyl hydrolases family 18.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIB60827.1	1.32e-229	1	348	1	348
BDA10778.1	5.37e-229	1	348	1	348
CBL05325.1	1.74e-176	11	285	2	276
SNU93874.1	3.39e-158	17	348	6	345
QJW48079.1	1.48e-106	37	348	166	480

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CZ8_A	4.72e-24	97	330	73	307	ChainA, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
4S3K_A	2.21e-22	105	342	182	423	ChainA, Spore germination protein YaaH [Priestia megaterium QM B1551]
4S3J_A	5.37e-20	76	342	147	421	Crystalstructure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_B Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_C Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876]
5JH8_A	1.05e-18	102	346	73	314	Crystalstructure of chitinase from Chromobacterium violaceum ATCC 12472 [Chromobacterium violaceum ATCC 12472]
4Q6T_A	4.43e-17	80	347	52	340	Thecrystal structure of a class V chitininase from Pseudomonas fluorescens Pf-5 [Pseudomonas protegens Pf-5]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32258	1.30e-34	61	344	52	341	Uncharacterized glycosylase YvbX OS=Bacillus subtilis (strain 168) OX=224308 GN=yvbX PE=3 SV=1
O05495	1.00e-23	97	330	165	399	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2
P37531	1.82e-22	97	343	170	420	Cortical fragment-lytic enzyme OS=Bacillus subtilis (strain 168) OX=224308 GN=sleL PE=1 SV=2
O31682	4.81e-22	52	254	16	214	Putative glycosylase YkvQ OS=Bacillus subtilis (strain 168) OX=224308 GN=ykvQ PE=3 SV=1
P0DPJ9	1.32e-18	76	342	146	420	Cortical fragment-lytic enzyme OS=Bacillus anthracis OX=1392 GN=sleL PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.022518	0.957765	0.018753	0.000354	0.000276	0.000289

TMHMM  Annotations     

start	end
7	27