CAZyme Information: MGYG000004744_01762

Basic Information

• Species: Megamonas sp900556715
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Selenomonadales; Selenomonadaceae; Megamonas; Megamonas sp900556715
• CAZyme ID: MGYG000004744_01762
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
329		37456.14	9.502

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004744	2057636	MAG	Denmark	Europe

• Gene Location: Start: 165; End: 1154 Strand: -

Full Sequence      

MRKILIVNRLGIGDVVLTTPLAQIIKENLKDVKIGFLVASKSIDILKNHPYIDEIFAYKN
KQEKKQIINEIKEKEYTEAIIVDGRLSSTIIAWKAKCKLLNKGFCVSINKKHFFERKNLA
QKAIDDFAMYAKILLNIDYDKNELYPLIGKCDSGKEKIIKSWVESIKKETKDIVLIVPRT
AADIKNWNIHELGKLNSYLNLEGIKPVYIGSPNDYEYIEKIAGEKINIAGKFALRDIPEI
AKYAKWALSMCTGPLHILGTVKSLPIIAIYGPSDPKRWAPKSSIVVQSNLECVPCLNWAK
CDKALGQRCMDEITFERVKNVIEEYNLLK

Enzyme Prediction     

No EC number prediction in MGYG000004744_01762.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	66	300	4.8e-27	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	3.20e-43	3	324	1	277	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	3.19e-36	1	325	1	329	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	7.12e-14	70	296	7	237	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10422	PRK10422	6.89e-09	2	287	6	305	lipopolysaccharide core biosynthesis protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BDA10839.1	2.07e-237	1	329	1	329
AIF53735.1	4.46e-116	1	324	1	319
ACI21302.1	1.33e-28	2	328	6	332
BBB91612.1	2.52e-28	1	324	7	327
ATV66203.1	6.90e-25	2	323	5	332

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TOV_A	2.25e-13	2	280	9	297	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P25742	1.46e-09	13	287	5	293	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli (strain K12) OX=83333 GN=rfaQ PE=3 SV=2
Q9R9D5	4.64e-09	13	287	5	293	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004744_01762.