CAZyme Information: MGYG000004745_00081

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; CAG-110
• CAZyme ID: MGYG000004745_00081
• CAZy Family: GH65
• CAZyme Description: Kojibiose phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
726	MGYG000004745_3|CGC1	81865.28	5.2911

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004745	1259383	MAG	China	Asia

• Gene Location: Start: 10456; End: 12636 Strand: +

Full Sequence      

MSGLRITPWRIESRDLVGRSYRESIFSLGNGYMGTRGYRPDERGEHPAWRSTFLAGFYEY
VKPGITDLVNHPDFSGIQFHLNGIDSEAHTVSDFVQTLDLRCGLAAWEYILEDPAGNRTH
VKQEKFLSMADHHTAAIRIRLTPLNWSGPLELSGGIDASVENLPVSDDQLTENVEFVKIW
SDVWTEAIPGGGILTAETGISRRRIAQVYLLSGEGSGETTAGSKGITTTLRAQLVRGTAW
ACEKRVAVASFRDGDPEELVRKKAEALGSTTFDRLLEESTEAWAKLWEASDVQITGNDEW
QGAIRYNIFQLMQAMPYGDPYASIGARGLTHGRYKGCYFWDTEIFMLPFFAYTQPDAART
LLEYRYHTLPDAVESAARFSAKGARYSWMSSDTGFEQCGTWDTGCCEIHITADIAHAIGQ
YAALTGDKAFMRDCGTEILLQTARYWVDRFNYSASEDRYHLLFVKGPDEYCGVTVDDFYT
VSLARDHLTLAAASVQWMQEAYPQVWEALADKTGFRPEESEKWRDISAKVVLRCDGKNSL
WKQDATFDLLEPLDIQAHKDDDVPLYHKIGFDRLQRYQVLKQPAVLMYMALCPEKFSRQE
IEAAWDYYEPKTLHDSTLSFGIHALLAARLGREEQAVRYFEKSLFLDLKNVMQNTGKEGI
HTASLGATWQALVLGFGGLSVDSGTPAVENRLPAGIEEMRYRIRYKGIPYRIVLRKNRAP
EVIPEG

Enzyme Prediction     

No EC number prediction in MGYG000004745_00081.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH65	305	682	3.5e-123	0.9919354838709677

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1554	ATH1	0.0	6	719	8	738	Trehalose and maltose hydrolase (possible phosphorylase) [Carbohydrate transport and metabolism].
PRK13807	PRK13807	1.59e-132	6	707	7	715	maltose phosphorylase; Provisional
pfam03632	Glyco_hydro_65m	6.90e-110	305	685	1	386	Glycosyl hydrolase family 65 central catalytic domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. The central domain is the catalytic domain, which binds a phosphate ion that is proximal the the highly conserved Glu. The arrangement of the phosphate and the glutamate is thought to cause nucleophilic attack on the anomeric carbon atom. The catalytic domain also forms the majority of the dimerization interface.
pfam03636	Glyco_hydro_65N	4.45e-48	22	250	13	239	Glycosyl hydrolase family 65, N-terminal domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. This domain is believed to be essential for catalytic activity although its precise function remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUI20960.1	3.00e-189	8	706	9	717
ADL03795.1	6.92e-182	4	714	2	706
QRV21887.1	6.92e-182	4	714	2	706
SET57222.1	2.30e-174	4	714	2	699
QKN24491.1	2.11e-160	4	717	5	709

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIQ_A	6.26e-105	9	707	8	722	Crystalstructure of kojibiose phosphorylase complexed with kojibiose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_A Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_B Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_C Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_D Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903]
1H54_A	1.24e-77	6	684	7	694	ChainA, Maltose Phosphorylase [Levilactobacillus brevis],1H54_B Chain B, Maltose Phosphorylase [Levilactobacillus brevis]
4KTP_A	2.10e-74	7	707	12	717	ChainA, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTP_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]
4KTR_A	4.02e-74	7	707	12	717	ChainA, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_C Chain C, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_D Chain D, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_E Chain E, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_F Chain F, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_G Chain G, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_H Chain H, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]
7FE3_A	1.99e-32	8	693	23	656	ChainA, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_A Chain A, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8RBL8	5.10e-112	23	707	32	737	Kojibiose phosphorylase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) OX=273068 GN=kojP PE=3 SV=1
Q8L163	5.06e-108	23	716	35	749	Kojibiose phosphorylase OS=Thermoanaerobacter brockii OX=29323 GN=kojP PE=1 SV=1
Q8L164	2.32e-103	12	726	19	754	Alpha,alpha-trehalose phosphorylase OS=Thermoanaerobacter brockii OX=29323 GN=treP PE=1 SV=1
E6ENP7	8.45e-90	5	706	28	734	Maltose phosphorylase OS=Enterococcus faecalis (strain TX4000 / JH2-2) OX=749493 GN=malP PE=1 SV=1
O06993	3.82e-79	6	706	9	712	Maltose phosphorylase OS=Bacillus subtilis (strain 168) OX=224308 GN=mdxK PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999777	0.000260	0.000010	0.000000	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004745_00081.