CAZyme Information: MGYG000004745_00269

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; CAG-110
• CAZyme ID: MGYG000004745_00269
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
856	MGYG000004745_11|CGC1	95471.33	4.4858

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004745	1259383	MAG	China	Asia

• Gene Location: Start: 9264; End: 11834 Strand: -

Full Sequence      

MAKKEKQEFDQEKKLHIAWRIGRVVLAVLGKLVLFVLAAFGTFLLVCAVAGSIFAMKLKD
YLKTDVIPAAEAAADSLELDNVSLAQTSFIYYIDPETGEERELQQLQTTENRVWVSYDKI
PVDMVNATIAIEDKRFREHNGVDWLRTLSAIANFAGGDSSYGASTITQQLIKNLTHEDDV
TVNRKVQEIFCALAAEKMYTKNEIMEWYLNTIYLGEGCYGVQSAARVYFGKDVSELSTAE
CASLIGITNNPSLYDPYISEKNNRKRQLTILQEMYKQGYIETEEEYDAVTSEEMFFHNGT
YDEATYVCSECGFEGTKEDYTKGEDGVYYCPNCETPNYTVSDSHYYSYYVDAVYNDVLKD
LCEKYGYSEKAAAMKLMTGGYKIYCNYDPRAQAIVDRVYENLDNVPKTVSMQQLQSALIL
IDNATGDIVAMSGGVGEKEGSLIHNRATMSLLPTGSSFKPISVYAPALEAGIITPASVYE
DSSLYDDRNWPLNDSRTYSGLCNIMRGLSSSLNTISVKTLNDLGVMNSYKFLTEKMGITS
LVEEETIGGKNYTDIALAPLALGQQTHGVSVREMAQAFATFPNNGVFREARLYTKVVNQN
GELILDNTQESHTAIGEKASFYINYMLQNAASYGTGSAASMSNMSVAGKTGTTSSNQDRW
FAGYTPYYTAVVWCGYDEPEQVILSGSYTNPAVVMWKKVMQPLHENLEYASFYQPDGVGS
YKVCEDCGLLADVACEKDVRNGSNRVTTLRLFYDDAPKAKCTCHTLVKICKESGKIANEY
CYLAEGNTIEEVGKLIYNEDWKVNKDADFVYNEKDEDAVCKLHTEENTKPTVPTLPTEPT
EPTEPSWGGWPGLPWH

Enzyme Prediction     

No EC number prediction in MGYG000004745_00269.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	102	275	3e-63	0.9774011299435028

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02074	PBP_1a_fam	7.34e-169	111	706	1	531	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	4.64e-156	31	722	9	619	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	1.03e-113	31	732	3	747	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	5.91e-78	110	275	11	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
PRK11636	mrcA	2.40e-59	40	678	3	745	penicillin-binding protein 1a; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBB65500.1	2.29e-193	41	773	6	706
ALP94484.1	5.99e-193	41	773	38	738
QNL43378.1	7.47e-193	41	800	31	742
QIA31344.1	1.59e-186	41	824	35	807
ANU41033.1	8.68e-186	41	824	11	783

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZG8_B	3.53e-62	196	681	4	437	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]
3ZG7_B	6.01e-57	196	681	4	437	CrystalStructure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the apo form [Listeria monocytogenes]
7U4H_A	8.93e-56	100	739	28	797	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
4OON_A	2.19e-50	112	723	39	742	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
3DWK_A	9.38e-49	103	681	18	562	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0TNZ8	1.02e-97	83	765	67	725	Penicillin-binding protein 1A OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=pbpA PE=3 SV=1
Q0SRL7	1.62e-94	83	765	67	725	Penicillin-binding protein 1A OS=Clostridium perfringens (strain SM101 / Type A) OX=289380 GN=pbpA PE=3 SV=1
Q8XJ01	1.96e-90	83	709	67	671	Penicillin-binding protein 1A OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=pbpA PE=3 SV=1
A7FY32	2.56e-87	103	780	67	718	Penicillin-binding protein 1A OS=Clostridium botulinum (strain ATCC 19397 / Type A) OX=441770 GN=pbpA PE=3 SV=1
A5I6G4	2.56e-87	103	780	67	718	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) OX=441771 GN=pbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000006	0.000017	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
32	54