CAZyme Information: MGYG000004747_00564

Basic Information

• Species: Blautia sp900753905
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia; Blautia sp900753905
• CAZyme ID: MGYG000004747_00564
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
302	MGYG000004747_8|CGC1	34489.97	9.773

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004747	2765913	MAG	Spain	Europe

• Gene Location: Start: 31397; End: 32305 Strand: -

Full Sequence      

MTVTVIIPTYKPDGTFQKLIEKLKTQTYPIKKILILNTEAKYWKKDWIKGIPQAEVHHIT
KEEFDHGKTRAMGAAMAETDLLVFFTQDAVPANNKVIEVLVNSFADDSIGAAYGRQLPAA
DCKFIEQYTRGFNYPENSRVKRKEDLPKLGIKTYFCSNVCAAYRRCVYEKLGGFVTKTIF
NEDMILAAQMIQAGYGVAYAARAEVIHSHNYSYFQQFQRNFDLAVSQADHPEIFAKISSE
SEGMRLVKQTASYLLKQKKPWLIPDLVLISGFKFLGYKAGQNYQKLPKGLVKKFTMNPSY
WK

Enzyme Prediction     

No EC number prediction in MGYG000004747_00564.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	4	171	7.5e-17	0.9882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1215	BcsA	1.60e-14	2	205	55	262	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	9.56e-11	5	179	1	177	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
pfam00535	Glycos_transf_2	1.12e-10	4	165	1	161	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG0463	WcaA	6.42e-09	1	219	3	211	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd06439	CESA_like_1	1.23e-08	2	203	30	224	CESA_like_1 is a member of the cellulose synthase (CESA) superfamily. This is a subfamily of cellulose synthase (CESA) superfamily. CESA superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members of the superfamily include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWY99516.1	5.99e-148	1	301	1	301
QBE96877.1	2.66e-145	2	301	5	304
QMW79879.1	2.66e-145	2	301	5	304
QIB57343.1	2.66e-145	2	301	5	304
QJU13078.1	1.53e-144	2	301	5	304

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26403	4.57e-71	1	301	1	302	O antigen biosynthesis rhamnosyltransferase RfbN OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfbN PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004747_00564.