CAZyme Information: MGYG000004747_01213

Basic Information

• Species: Blautia sp900753905
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia; Blautia sp900753905
• CAZyme ID: MGYG000004747_01213
• CAZy Family: GH127
• CAZyme Description: Non-reducing end beta-L-arabinofuranosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
647	MGYG000004747_21|CGC1	74764.95	4.7902

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004747	2765913	MAG	Spain	Europe

• Gene Location: Start: 10806; End: 12749 Strand: +

Full Sequence      

MLEKKLHSLSLNQIQIEDMFWKEYMELVRNHVIPYQWEALNDRIKEAEPSYCIQNFRVAA
KLEEGSFQGMVFQDSDVYKWLEAVAYSLMWHPDEKLEQTADETIDLIAAAQQPDGYLDTY
YIINGLEKRFTNLMDHHELYCLGHMVEAAVAYYKATGKRKFLDVAIAYADCVAEHLGTED
GKIPGYPGHEVAEMALVALYEVTGEERHLNLAKYFIDQRGQEPLFFNEECKKNDNKCFWD
DTYMQKQYYQAGKPVREQEKAEGHAVRAVYLYSGMAEVASATEDAELFKVCEKIWDNIVK
KQMYVTGAIGATEHGEAFSFDYDLPNDTVYAETCAAIGLIFFARRMFEITKDSKYTDIME
RALFNGVISGMSLDGKSFFYVNPLEVNPEACEKDYFKRHVKPVRQKWFGCACCPPNVARL
LSSIGGYAFECSEDAIYMNLFVGGQIEAALNGKKNRFHVETQYPWEGTVKIKVENQEDSS
FTYAVRIPGWCQNYELTINGVKPEHYVEKGYAILNHVWKNGDEILLKMDMPVTLVEANPR
VREDIGKVAVMRGPVVYCLEEIDNQDQLQEIYLEENPVFTETFEKDLLKGVVTLKTQGKR
LSEKNWGEETLYRPYRGRTYEKQELTFIPYYAWTNRGIGEMTVWVRI

Enzyme Prediction     

No EC number prediction in MGYG000004747_01213.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	15	558	4.5e-234	0.9961832061068703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3533	COG3533	0.0	11	646	9	586	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam07944	Glyco_hydro_127	0.0	18	558	6	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
cd04791	LanC_SerThrkinase	1.17e-04	148	363	94	275	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.
COG4225	YesR	2.52e-04	139	286	42	175	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
COG4403	LcnDR2	0.002	150	240	752	837	Lantibiotic modifying enzyme [Defense mechanisms].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJU14959.1	0.0	1	647	1	647
ANU74938.1	0.0	1	647	1	647
ASU27747.1	0.0	1	647	1	647
QQQ92494.1	0.0	1	647	1	647
QMW77738.1	0.0	1	647	1	647

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	3.10e-260	14	646	16	646	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	1.19e-252	14	646	16	646	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
3WRE_A	1.32e-173	14	646	3	657	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]
3WKW_A	1.88e-173	14	646	3	657	Crystalstructure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum ligand free form [Bifidobacterium longum subsp. longum JCM 1217],3WKX_A Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum arabinose complex form [Bifidobacterium longum subsp. longum JCM 1217],7BZL_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7DIF_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXV_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXW_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]
7EXU_A	5.30e-173	14	646	3	657	ChainA, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	7.23e-173	14	646	3	657	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000029	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004747_01213.