CAZyme Information: MGYG000004748_00463

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000004748_00463
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
274	MGYG000004748_2|CGC2	31823.18	4.6972

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004748	4696076	MAG	China	Asia

• Gene Location: Start: 91539; End: 92363 Strand: -

Full Sequence      

MTKANKVLFITQEITPYVPESEMSLAGRNLPQAIQEKGREIRTFMPKWGNINERRNQLHE
VIRLSGMNLIIDDTDHPLIIKVASIQAARMQVYFIDNDDYFQNRMQEVDENGVEYEDNDA
RAIFYARGVLETVKKLRWCPDVIHCQGWMTALAPLYIKKAYKDEPSFRDAKVVFSLYDND
FKEPFHADFATKLMLKGITKKDIADLKEPIDYVALCKLAIDYSDGVIQQSEHVNEEVMEY
ARKAGKPILEYQSPENFADACNDFYDKVWEAEQE

Enzyme Prediction     

No EC number prediction in MGYG000004748_00463.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	6	241	2.6e-46	0.4745762711864407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08323	Glyco_transf_5	1.62e-56	7	245	1	232	Starch synthase catalytic domain.
PRK14098	PRK14098	1.38e-40	1	178	1	180	starch synthase.
cd03791	GT5_Glycogen_synthase_DULL1-like	2.08e-31	6	176	1	164	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK00654	glgA	2.44e-23	6	175	2	152	glycogen synthase GlgA.
COG0297	GlgA	5.17e-23	6	176	2	164	Glycogen synthase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRQ48309.1	8.69e-191	1	274	1	274
QUT46066.1	8.69e-191	1	274	1	274
ADV43462.1	9.67e-186	1	273	1	273
QUT66555.1	7.65e-185	1	273	1	273
QUT60752.1	7.65e-185	1	273	1	273

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B4SC83	2.08e-36	1	178	1	180	Glycogen synthase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) OX=324925 GN=glgA PE=3 SV=1
B3EGV0	1.48e-35	6	178	7	180	Glycogen synthase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330) OX=290315 GN=glgA PE=3 SV=1
B4S584	5.58e-35	6	231	7	229	Glycogen synthase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) OX=290512 GN=glgA PE=3 SV=1
Q3B6C3	2.00e-34	1	178	1	180	Glycogen synthase OS=Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530) OX=319225 GN=glgA PE=3 SV=1
A1BIY8	7.35e-34	6	178	7	180	Glycogen synthase OS=Chlorobium phaeobacteroides (strain DSM 266) OX=290317 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004748_00463.