CAZyme Information: MGYG000004748_01101

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000004748_01101
• CAZy Family: GH3
• CAZyme Description: Xylan 1,4-beta-xylosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
863	MGYG000004748_4|CGC3	96366.34	7.1791

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004748	4696076	MAG	China	Asia

• Gene Location: Start: 105140; End: 107731 Strand: -

Full Sequence      

MKKQWIIACLSGLFAVNIQAQLPAKYPYQDTKLTAEQRADDLLPRLTLEEKVALMQNNSP
AIPRLGIKPYEWWNEALHGVARAGLATVFPQAIGMGASFNDKLLYEVFDAVSDEARAKNR
RFNENGSYRRYQGLTMWTPNVNIFRDPRWGRGQETYGEDPYLSGQLGMAVVRGLQGPEDA
EYDKLHACAKHFAVHSGPEWNRHSFNAENIAPRDLWETYLPAFKDLVQKAGVKEVMCAYN
RYEGDPCCGSERLLNQILRNEWGFKGMVVSDCGAISDFYSPKKHFTHPDAASASAAAVLS
GTDVECGSSYKSLTEAVAKGAITEDKINISVRRLLIARFQLGEMNEKHPWAHIPYSVVDS
PKHKELALRMAHETIVLLQNKNQILPLNKDIKIAVLGPNANDSVMQWGNYNGFPSQTTTL
LKAIQKRFPASQIIYEPACGHTDAITLQSLFNQCSIDGKPGFSAEYWNNREYQGDIAAVD
QLSTPFHFSSQGAIAFAAGVNLKDFTAIYRSTFRPDHNGSAAFRLMTNGGVTLSIDGKIV
AERSNVKNPDNLYHFIYEAGKAYNIELKFIQERNDPFLNFDLAQEKPVNIPELLTNVKDA
DVVLFAGGISPLLEGESMSVSAPGFKGGDRLTIELPDAQRNILKELKKAGKKVIFINYSG
SAMALTPETESCDAILQAWYPGQDGGTAVADVLFGDYNPAGRLPITFYKNTDQLPDYEEY
SMKNRTYRFFKEEPLFPFGYGLSYTKFTYGKVKADKKSLAKNETLTLQIPVTNIGNHDGE
EVVQVYLRRPSDVEGPAKTLRAFQRVKIAKGTTQTVKLELPYENFAWFDTATNTMRTLQG
KYEVLYGGSSKEKDLQTVSILVK

Enzyme Prediction     

EC	3.2.1.37	3.2.1.-	3.2.1.21	3.2.1.55

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	61	306	6e-72	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN03080	PLN03080	2.28e-118	1	848	1	763	Probable beta-xylosidase; Provisional
PRK15098	PRK15098	2.70e-113	1	820	1	725	beta-glucosidase BglX.
COG1472	BglX	3.51e-70	30	402	14	366	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	3.89e-50	375	744	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	8.74e-46	64	335	63	314	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ48974.1	0.0	1	863	1	863
QRQ55783.1	0.0	1	863	1	863
SCV08392.1	0.0	1	863	1	863
QUT78056.1	0.0	1	863	1	863
QGT73519.1	0.0	1	863	1	863

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VC7_A	6.57e-92	38	844	25	715	ChainA, xylan 1,4-beta-xylosidase [Phanerodontia chrysosporium]
7VC6_A	6.57e-92	38	844	25	715	ChainA, xylan 1,4-beta-xylosidase [Phanerodontia chrysosporium]
5Z87_A	2.95e-86	52	851	108	775	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5XXL_A	4.89e-77	50	852	67	743	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	2.44e-76	50	852	67	743	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D5EY15	1.41e-295	27	860	23	859	Xylan 1,4-beta-xylosidase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyl3A PE=1 SV=1
Q94KD8	5.26e-103	14	860	30	763	Probable beta-D-xylosidase 2 OS=Arabidopsis thaliana OX=3702 GN=BXL2 PE=2 SV=1
Q9FGY1	4.83e-98	10	820	31	735	Beta-D-xylosidase 1 OS=Arabidopsis thaliana OX=3702 GN=BXL1 PE=1 SV=1
A5JTQ2	1.35e-94	11	820	36	737	Beta-xylosidase/alpha-L-arabinofuranosidase 1 (Fragment) OS=Medicago sativa subsp. varia OX=36902 GN=Xyl1 PE=1 SV=1
Q4WFI6	1.27e-93	30	848	44	734	Probable exo-1,4-beta-xylosidase bxlB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bxlB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000372	0.998810	0.000287	0.000172	0.000173	0.000159

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004748_01101.