CAZyme Information: MGYG000004748_01202

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000004748_01202
• CAZy Family: PL13
• CAZyme Description: Heparin lyase I

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
421		47396.24	4.9069

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004748	4696076	MAG	China	Asia

• Gene Location: Start: 235124; End: 236389 Strand: -

Full Sequence      

MKINLLSGLLLSGIILVSCSTSEPVNELPPPPDNTETPDSPGETETPDEPGKEPEKDPTG
PIITRVNIQTELATADKIVGGEWVAIGSKKEHALQYDPAVLYNGQPSYRFELKGPEDNTI
GGYQDAEKGRTELSYCYATPQDFADKTAETLNIAQQLKYVYHFGKGIIPQGATSKHVFSF
YMPEDIDSETKCIFAQIHGMPDRTLVKDPSGRTYKMSEDEYLDLIQRSIFEDNIGYEKVF
VRNDKNGKPVYEKGQKNGYLIDGGGFPPLSCGVHGGWVYIKCMSDRKWITDLTERDHQVN
PVKNEIMQEQTSDKGYKKHLLAWKTPLKDFPKGRWVTFDFEIKWSKFSGETEIEEPGSLN
VVMSYTDDGGQVVTKQIVEPTRPVHIGHNNEEGHYFKFGIYRPDSEIPVHWNLAGYSQTI
L

Enzyme Prediction     

EC	4.2.2.7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL13	59	419	1.2e-120	0.9807162534435262

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14099	Polysacc_lyase	3.13e-11	92	406	18	199	Polysaccharide lyase. This family includes heparin lyase I, EC:4.2.2.7. Heparin lyase I depolymerizes heparin by cleaving the glycosidic linkage next to an iduronic acid moiety. The structure of heparin lyase I consists of a beta-jelly roll domain with a long, deep substrate-binding groove and an unusual thumb domain containing many basic residues extending from the main body of the enzyme. This family also includes glucuronan lyase, EC:4.2.2.14. The structure glucuronan lyase is a beta-jelly roll.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI64405.1	1.38e-114	61	418	28	390
ADL62736.1	1.31e-112	61	414	32	389
QUT44448.1	1.80e-110	61	418	32	393
AAO79780.1	2.02e-110	61	418	14	375
QMW89253.1	2.02e-110	61	418	14	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ILR_A	6.06e-112	61	418	8	369	Structureof Heparinase I from Bacteroides thetaiotaomicron in complex with tetrasaccharide product [Bacteroides thetaiotaomicron]
3IKW_A	6.91e-112	61	418	12	373	Structureof Heparinase I from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron]
3IMN_A	3.16e-111	61	420	14	377	Crystalstructure of heparin lyase I from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],3IN9_A Crystal structure of heparin lyase I complexed with disaccharide heparin [Bacteroides thetaiotaomicron]
3INA_A	1.02e-109	61	420	14	377	Crystalstructure of heparin lyase I H151A mutant complexed with a dodecasaccharide heparin [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q05819	1.05e-99	55	419	22	382	Heparin lyase I OS=Pedobacter heparinus OX=984 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000062	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004748_01202.