CAZyme Information: MGYG000004748_01305

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000004748_01305
• CAZy Family: PL38
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
791	MGYG000004748_5|CGC1	91647.66	8.1691

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004748	4696076	MAG	China	Asia

• Gene Location: Start: 126; End: 2501 Strand: -

Full Sequence      

MRLKTKLWIVVLLLLTANLQAQSIWDATHLTNVKQSLQNPFYATAYQELKSKADKLLNVQ
PLSVMMKEKTPGSGDKHDYMSQARYYWADPSKPDGLPYISRDGVSNPELEKLDRNRLGDT
AGRITTLALAWYFSGDEKYAQKATELIRVWFFNKDTRMNPNLEYAQMIPGRYNNKGRCFG
VIDTYSFVEMLDAVKLLEKSKSFTPKDAKQLKAWFGKLLNWILNSPQGQEESRQANNHST
AHDAQAIAFALYAGNIKVAQEVINAIPAKRIFTQIEPDGRQPQELRRTLAFGYSQYNLTH
LIDIFLMAQKINIHIDNATSTDGRNFYKAMDFLTQYVGKDVKAWPYQQISEWDYKQQEFC
KDLYRCATYLNPARKDYLQLYSDNRVIDWKDRFNLLYMQPTEVDNAYAFACNQLNFAITC
ANKARKEQDNQCKRRVMPRSTNKDGSLRMIHPNDWCSGFFPGSLWQVYAYTHDDYWRQQA
ISFTWLIEDAKWNKGTHDLGFMMNNSFGKAWELTGERSYKDVVLQSAKTLITRYNPKVKC
IRSWDHNRDKWKYPVIIDNLMNLEMLFRATQETGDSIYWNIAINHANTTMKNHFRPDYSS
FHVVDYDPETGAVRARQTAQGFSDDSFWSRGQGWGLYGYTMCYRFTKDPAYLAQARNIAD
FFFGLPNLPEDFIPYWDMKAPDIPNTSRDASAATIMASALYELSTYVSTADSQRYKKIAD
KIVDSLNKHYQAQPETTYGFLLLHSTGHHPGGDEIDVPLNYADYYYLEALARKEALDTKE
LISDTIQIVKE

Enzyme Prediction     

No EC number prediction in MGYG000004748_01305.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	452	772	1.2e-129	0.9787234042553191
PL38	64	340	6.5e-105	0.985663082437276

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05426	Alginate_lyase	4.02e-88	63	344	1	274	Alginate lyase. This family contains several bacterial alginate lyase proteins. Alginate is a family of 1-4-linked copolymers of beta -D-mannuronic acid (M) and alpha -L-guluronic acid (G). It is produced by brown algae and by some bacteria belonging to the genera Azotobacter and Pseudomonas. Alginate lyases catalyze the depolymerization of alginates by beta -elimination, generating a molecule containing 4-deoxy-L-erythro-hex-4-enepyranosyluronate at the nonreducing end. This family adopts an all alpha fold.
pfam07470	Glyco_hydro_88	3.07e-13	432	772	6	338	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO68113.1	0.0	1	775	1	774
QUT89187.1	0.0	1	776	1	775
ALJ59781.1	0.0	1	776	1	775
QUT65853.1	0.0	1	779	1	787
QUU01289.1	0.0	1	779	1	787

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NFV_A	1.50e-118	24	397	8	379	Crystalstructure of an alginate lyase (BACOVA_01668) from Bacteroides ovatus at 1.95 A resolution [Bacteroides ovatus ATCC 8483],3NNB_A Crystal structure of an alginate lyase (BACOVA_01668) from Bacteroides ovatus at 1.60 A resolution [Bacteroides ovatus ATCC 8483]
3WIW_A	1.48e-97	438	772	56	387	Crystalstructure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
2ZZR_A	3.53e-50	448	772	61	388	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	3.61e-50	448	772	62	389	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
3WUX_A	1.28e-49	448	772	62	389	Crystalstructure of unsaturated glucuronyl hydrolase mutant D115N/K370S from Streptococcus agalactiae [Streptococcus agalactiae NEM316]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KLZ3	9.19e-112	447	779	69	400	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
Q8DR77	8.27e-57	444	772	56	387	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
Q9A0T3	1.05e-53	438	772	53	390	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1
Q8E372	1.98e-49	448	772	62	389	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
Q9RC92	2.58e-47	444	774	29	365	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000287	0.998996	0.000228	0.000154	0.000155	0.000146

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004748_01305.