CAZyme Information: MGYG000004748_01491

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000004748_01491
• CAZy Family: CE1
• CAZyme Description: Endo-1,4-beta-xylanase/feruloyl esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
392	MGYG000004748_5|CGC7	44221.66	7.1161

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004748	4696076	MAG	China	Asia

• Gene Location: Start: 257766; End: 258944 Strand: -

Full Sequence      

MKIYQIAGIGLLAALHLLPMHAQQSHVNIDWAPQKNTENLVPLSANVISPEVNNDHTVTF
RLKAPQATDVRLTGNILGRITRERTLPFTKDTSGLWTLTVGPLEPNIYLYYFLVDGVNTT
DPNNTYTGHANMPAFSMVWVHGDGPAFYDARPVPHGNLTTHFYHSDVTQGERYMIVYTPP
MYDSKKTYPVLYLMGGSGDLPETWTMHGQINFIMDNLLAEGKMKPMIVVIPNNQLVHRMN
PKHTELSFPLTEREFTEAIIPFVESRYKVIQSPKGRAIAGLSMGGRHAQYIGLRHMDLFG
SIGLLSAALPLSDTPVLLNPKKVNDSLEYFFVGAGPYETFPKARHEILHHELDSLGVKHE
YYIGGPGAHDLQTWRHLMYERFLPNLFTHTNH

Enzyme Prediction     

No EC number prediction in MGYG000004748_01491.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	165	380	8.5e-46	0.9559471365638766

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2382	Fes	1.28e-34	83	387	2	296	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
cd11294	E_set_Esterase_like_N	1.29e-29	56	127	1	69	N-terminal Early set domain associated with the catalytic domain of putative esterases. E or "early" set domains are associated with the catalytic domain of esterase at the N-terminal end. Esterases catalyze the hydrolysis of organic esters to release an alcohol or thiol and acid. The term esterase can be applied to enzymes that hydrolyze carboxylate, phosphate and sulphate esters, but is more often restricted to the first class of substrate. The N-terminal domain of esterase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
pfam00756	Esterase	1.23e-16	165	327	1	166	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
cd02858	E_set_Esterase_N	5.00e-14	56	123	1	61	N-terminal Early set domain associated with the catalytic domain of esterase. E or "early" set domains are associated with the catalytic domain of esterase at the N-terminal end. Esterases catalyze the hydrolysis of organic esters to release an alcohol or thiol and acid. The term esterase can be applied to enzymes that hydrolyze carboxylate, phosphate and sulphate esters, but is more often restricted to the first class of substrate. The N-terminal domain of esterase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
cd02688	E_set	1.89e-09	58	134	2	76	Early set domain associated with the catalytic domain of sugar utilizing enzymes at either the N or C terminus. The E or "early" set domains of sugar utilizing enzymes are associated with different types of catalytic domains at either the N-terminal or C-terminal end. These domains may be related to the immunoglobulin and/or fibronectin type III superfamilies. Members of this family include alpha amylase, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase. A subset of these members were recently identified as members of the CBM48 (Carbohydrate Binding Module 48) family. Members of the CBM48 family include pullulanase, maltooligosyl trehalose synthase, starch branching enzyme, glycogen branching enzyme, glycogen debranching enzyme, isoamylase, and the beta subunit of AMP-activated protein kinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOS44237.1	2.72e-148	17	387	13	391
QDK80976.1	3.14e-147	10	387	8	392
QMW04333.1	6.31e-147	11	387	9	392
AKD56156.1	7.53e-146	11	387	9	392
QIA08077.1	1.03e-144	13	387	13	395

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MOT_A	2.52e-45	50	387	19	358	ChainA, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393]
6MOU_A	4.13e-45	50	387	40	379	ChainA, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393],6MOU_B Chain B, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393]
7B5V_A	4.66e-44	50	375	40	374	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]
6RZN_A	2.46e-43	45	387	20	385	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
6RZO_A	1.41e-42	50	380	17	337	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P31471	1.08e-49	51	387	42	388	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3
D5EY13	7.39e-34	50	387	395	725	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
D5EXZ4	8.17e-32	50	387	329	669	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
P10478	3.92e-27	145	375	36	266	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
P51584	4.58e-08	170	297	839	969	Endo-1,4-beta-xylanase Y OS=Acetivibrio thermocellus OX=1515 GN=xynY PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000287	0.998977	0.000201	0.000194	0.000165	0.000156

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004748_01491.