CAZyme Information: MGYG000004748_01839

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000004748_01839
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
306	MGYG000004748_7|CGC3	35589.73	10.0767

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004748	4696076	MAG	China	Asia

• Gene Location: Start: 123383; End: 124303 Strand: +

Full Sequence      

MKRIFRLAAILAILFISVAAQAQRRNARYNEYIKQYAPLAIEQMQEHKIPASITLSQGLL
ESGAGYSELARKSNNHFGIKCGSSWRGRTVRHDDDARQECFRAYSHPKASYEDHSLFLKR
GARYAFLFDLKITDYKGWARGLKKAGYATDPSYANRLITIIEDYELYQYDSQGLSKRESR
NWEKELKKKPWLASPHQVYIANDIAYVVARDGDTFELLGKEFDISWRKLVKYNDLHKDYT
LEAGDIIYLKGKKKKASKPYTVYIVRDGDSMHTISQKYGIRLKNLYKMNRKGAEYVPELG
DRLRLR

Enzyme Prediction     

No EC number prediction in MGYG000004748_01839.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	37	166	2.1e-35	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	2.57e-38	4	170	10	188	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
NF038016	sporang_Gsm	8.72e-38	32	170	163	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
smart00047	LYZ2	1.41e-27	31	170	10	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
TIGR02541	flagell_FlgJ	3.32e-25	31	161	150	290	flagellar rod assembly protein/muramidase FlgJ. The N-terminal region of this protein acts directly in flagellar rod assembly. The C-terminal region is a flagellum-specific muramidase (peptidoglycan hydrolase) required for formation of the outer membrane L ring.
pfam01832	Glucosaminidase	2.04e-24	37	166	1	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBJ17132.1	6.83e-202	1	306	1	307
QUT47310.1	1.33e-201	1	306	1	306
QRQ47886.1	1.89e-201	1	306	1	306
QUT34698.1	2.78e-201	1	306	1	307
QUT63083.1	3.95e-201	1	306	1	307

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VWO_A	1.63e-16	38	168	10	150	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	1.99e-16	38	168	11	151	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	1.38e-15	38	168	11	151	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]
5T1Q_A	1.61e-11	31	172	62	214	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
5DN4_A	5.48e-11	45	181	19	162	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	2.85e-15	47	170	67	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
P37710	4.96e-15	30	289	181	457	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
Q9I4P4	1.28e-11	20	168	230	389	Peptidoglycan hydrolase FlgJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=flgJ PE=3 SV=1
Q9X9J3	1.49e-11	32	165	163	306	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
Q2G222	1.02e-10	31	174	322	476	N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_02979 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000306	0.998931	0.000252	0.000167	0.000167	0.000154

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004748_01839.