CAZyme Information: MGYG000004748_02212

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000004748_02212
• CAZy Family: GT4
• CAZyme Description: Glycosyltransferase Gtf1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
361	MGYG000004748_10|CGC3	41220.18	9.0189

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004748	4696076	MAG	China	Asia

• Gene Location: Start: 86933; End: 88018 Strand: +

Full Sequence      

MKIVVTGTRGIPNIMGGVETHCEELFPRIAAKGFDITIMRRKSYVQDTLTEYQGVKLVDV
ETPKKKSFEAIIHTFKAILKAKKQKANLIHIHAIGPALLVPMARLLGMKVVFTHHGPDYD
RDKWGLAAKTMLKLGEHMGTKYANEVIVISNVINNNLKQKYGRKDCHLIYNGVPEPEICE
FPEYFKDLGIEKGKYILSMCRFVPEKNLHHLVEAFSRIDTKGYKLVLAGDTDFEDEYSLR
LKKLAREQEVILTGFVKGKKLHSLISNAHHYVLPSSHEGLPIALLEAMSYKLPVIVSDIP
ANKEIDLAEEIYFPVGNIEVLTDKLQKAINKPFYRIEYDMKKYNWNLISEQIIYIYNSLS
D

Enzyme Prediction     

No EC number prediction in MGYG000004748_02212.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	191	332	2e-29	0.90625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	5.29e-51	2	357	1	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	6.24e-39	1	359	1	377	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03808	GT4_CapM-like	1.95e-35	11	337	5	335	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.
cd03809	GT4_MtfB-like	1.55e-32	2	353	1	361	glycosyltransferases MtfB, WbpX, and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. MtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide.
cd04955	GT4-like	4.72e-32	2	351	1	373	glycosyltransferase family 4 proteins. This family is most closely related to the GT4 family of glycosyltransferases. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found in certain bacteria and Archaea.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFL79239.1	5.86e-197	1	356	1	356
QNL36957.1	5.68e-196	1	356	1	356
BBL13096.1	4.69e-191	1	356	1	356
BBL10303.1	4.69e-191	1	356	1	356
QUT84505.1	7.57e-185	1	359	1	360

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7EC7_A	3.56e-07	191	332	319	463	ChainA, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7EC7_B Chain B, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFO_A Chain A, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFO_B Chain B, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300]
7EC1_A	4.74e-07	191	332	320	464	ChainA, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7EC1_B Chain B, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7EC4_A Chain A, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7EC4_C Chain C, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7EC6_A Chain A, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7EC6_C Chain C, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFK_A Chain A, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFK_B Chain B, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFM_A Chain A, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFM_C Chain C, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFN_A Chain A, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFN_C Chain C, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300]
7EC3_A	4.74e-07	191	332	320	464	ChainA, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7EC3_C Chain C, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFL_A Chain A, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFL_C Chain C, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300]
5N7Z_A	8.64e-07	142	330	133	323	glycosyltransferasein LPS biosynthesis [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],6Y6G_A Chain A, Lipopolysaccharide 1,6-galactosyltransferase [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5N80_A	8.67e-07	142	330	134	324	glycosyltransferaseLPS biosynthesis in complex with UDP [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26402	1.80e-11	138	350	135	351	Protein RfbU OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfbU PE=3 SV=1
Q46634	1.85e-10	143	298	133	285	Amylovoran biosynthesis glycosyltransferase AmsD OS=Erwinia amylovora OX=552 GN=amsD PE=3 SV=2
Q65CC7	2.90e-09	90	335	91	353	Alpha-D-kanosaminyltransferase OS=Streptomyces kanamyceticus OX=1967 GN=kanE PE=1 SV=1
P54490	1.50e-08	84	297	70	281	Uncharacterized glycosyltransferase YqgM OS=Bacillus subtilis (strain 168) OX=224308 GN=yqgM PE=3 SV=2
P71055	9.15e-08	163	298	169	309	Putative glycosyltransferase EpsF OS=Bacillus subtilis (strain 168) OX=224308 GN=epsF PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004748_02212.