CAZyme Information: MGYG000004748_02792

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000004748_02792
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
429	MGYG000004748_17|CGC2	48933.03	5.2819

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004748	4696076	MAG	China	Asia

• Gene Location: Start: 45607; End: 46896 Strand: -

Full Sequence      

MKTHSFFTFLILLLCMMSCTSKQNQGEFITVENGHFMKDGRPYYYIGTNFWYGAILASEG
EGGNRKRLIAELDSLSAIGVDNLRILVGADGSNGVIAKVEPTLQTSPGVYNDTILAGLDF
LLYEMGKRNMSAILYLNNSWEWSGGYGQYLEWAGYGKAPIPAVDGWNKFQEFVQQYQKSD
SCKTLFANHVKNIVTRTNRYTNQKYINDPVIMSWQIGNEPRAFGEENKVCYALWMHSVAA
LIKRLDSNHLVSSGSEGYQGCEGDIQLWELIHSYNEVDYMTIHIWPYNWGWAKKDSLDNT
LGYSIEQTNIYIRKHQAIAEKYNKPIVIEEFGFPRDEFQFTIESSTQERDTYYASVFQQV
LANSMNQGALAGCNFWAWGGSAKKNVEHTFWVKGDDYMGDPAQEEQGLYSVFQSDKTVGM
IRDYNSKIQ

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	66	378	2.6e-92	0.9930795847750865

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3934	COG3934	2.46e-39	28	415	37	451	Endo-1,4-beta-mannosidase [Carbohydrate transport and metabolism].
cd19608	GH113_mannanase-like	0.009	266	379	169	282	Glycoside hydrolase family 113 beta-1,4-mannanase and similar proteins. Mannan endo-1,4-beta mannosidase (E.C 3.2.1.78) randomly cleaves (1->4)-beta-D-mannosidic linkages in mannans, galactomannans and glucomannans and is also called beta-1,4-mannanase, endo-1,4-beta-mannanase, endo-beta-1,4-mannase, beta-mannanase B, beta-1, 4-mannan 4-mannanohydrolase, endo-beta-mannanase, beta-D-mannanase, 1,4-beta-D-mannan mannanohydrolase, and 4-beta-D-mannan mannanohydrolase. (1->4)-beta-linked mannans are polysaccharides with a linear polymer backbone of (1->4)-beta-linked mannose units (in plants and fungi) or alternating mannose and glucose/galactose units (glucomannan in plants and fungi, and galactomannan and galactoglucomannan in plants), such as in the hemicellulose fraction of hard- and softwoods. Complete degradation of mannan requires a series of enzymes, including beta-1,4-mannanase. According to the CAZy database beta-1,4-mannanases are grouped into various glycoside hydrolase (GH) families; GH family 113 beta-1,4-mannanases include mostly bacterial and archaeal sequences.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO67759.1	3.66e-231	12	428	11	427
ALJ59276.1	1.04e-199	7	429	5	428
QUT89666.1	2.09e-199	7	429	5	428
AVM59109.1	5.09e-194	12	429	30	448
ADY36271.1	4.31e-191	10	428	10	433

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1UUQ_A	2.10e-110	27	429	23	430	Exo-mannosidasefrom Cellvibrio mixtus [Cellvibrio mixtus],1UZ4_A Common inhibition of beta-glucosidase and beta-mannosidase by isofagomine lactam reflects different conformational intineraries for glucoside and mannoside hydrolysis [Cellvibrio mixtus],7ODJ_AAA Chain AAA, Man5A [Cellvibrio mixtus]
4LYP_A	1.41e-75	16	428	21	440	CrystalStructure of Glycoside Hydrolase Family 5 Mannosidase from Rhizomucor miehei [Rhizomucor miehei],4LYP_B Crystal Structure of Glycoside Hydrolase Family 5 Mannosidase from Rhizomucor miehei [Rhizomucor miehei]
4LYQ_A	1.10e-74	16	428	21	440	CrystalStructure of Glycoside Hydrolase Family 5 Mannosidase from Rhizomucor miehei, E202A mutant [Rhizomucor miehei],4NRR_A Crystal Structure of Glycoside Hydrolase Family 5 Mannosidase (E202A mutant) from Rhizomucor miehei in complex with mannosyl-fructose [Rhizomucor miehei],4NRR_B Crystal Structure of Glycoside Hydrolase Family 5 Mannosidase (E202A mutant) from Rhizomucor miehei in complex with mannosyl-fructose [Rhizomucor miehei],4NRS_A Crystal Structure of Glycoside Hydrolase Family 5 Mannosidase (E202A mutant) from Rhizomucor miehei in complex with mannobiose [Rhizomucor miehei],4NRS_B Crystal Structure of Glycoside Hydrolase Family 5 Mannosidase (E202A mutant) from Rhizomucor miehei in complex with mannobiose [Rhizomucor miehei]
4LYR_A	1.10e-74	16	428	21	440	GlycosideHydrolase Family 5 Mannosidase from Rhizomucor miehei, E301A mutant [Rhizomucor miehei]
1RH9_A	5.13e-32	24	376	2	334	ChainA, endo-beta-mannanase [Solanum lycopersicum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6Z310	2.47e-39	26	376	37	366	Putative mannan endo-1,4-beta-mannosidase 9 OS=Oryza sativa subsp. japonica OX=39947 GN=MAN9 PE=2 SV=2
Q0JKM9	1.04e-38	26	376	35	371	Mannan endo-1,4-beta-mannosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=MAN1 PE=2 SV=2
Q10B67	1.13e-36	29	376	24	357	Mannan endo-1,4-beta-mannosidase 4 OS=Oryza sativa subsp. japonica OX=39947 GN=MAN4 PE=2 SV=2
Q9FJZ3	3.54e-36	1	376	1	362	Mannan endo-1,4-beta-mannosidase 7 OS=Arabidopsis thaliana OX=3702 GN=MAN7 PE=2 SV=1
O48540	6.98e-35	12	376	12	354	Mannan endo-1,4-beta-mannosidase 1 OS=Solanum lycopersicum OX=4081 GN=MAN1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000020	1.000038	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004748_02792.