CAZyme Information: MGYG000004748_02961

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000004748_02961
• CAZy Family: CBM62
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
653	MGYG000004748_20|CGC1	76108.23	5.7084

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004748	4696076	MAG	China	Asia

• Gene Location: Start: 23076; End: 25037 Strand: -

Full Sequence      

MNCWRVLCIGFVLALFMACSSENRWLETALSLAGDNRAELQKVLDRYKEEDGDKYRAACY
LIENMPFHGAYEGKALDNYRKYFSEYVSFPYSKHVQELIDSLKKADGEFSMSQLIYKCDI
ETVDSAFLVNHIEWAFKVWHEQPWGKYVDFETFRECILPYRIGDEPLSLWRKEVYERYNP
MLDEFRKTRGADDPKTAAQLLMDTLRQADYRHTALFPAGPHLGPDVLKWHTGSCREFTDA
MIYVLRALGIPCGIDWVVLLGDNNASHFWNFVLDKEGQTYIANLPYEEKWLKTEEYDISK
GKMYRTTYGIDKETALKLGEYQNVYPSFRRPLFRDVTALYTGKRNWCVSLPDSLLSRRFH
EGDLLYLCLANRMQWQPIGYTFFKDGEARFEDVGGEVVLTLVAWNGKEYATVSPPFFLER
ETGKIRFITPEAEKQELVLYRKCNLYMSFLYNSRMVGGVVEGSDRADFGRADTLFLIKEP
PYRLNTVARLRSDRPYRYMRYKGADGCFCDISELAFYKNMEDSVPLHGKVMGTPGSSEDN
THEYWNAFDGNPNTSFDYIHPDGGWTGMDFGTPCRVEKVVYTPRNEVNFIYKDNLYELFY
WDNGKWNSVGQQVAVSDSVVYSAPKSALFYLKNHTTGKDERIFEYKDGKQCFW

Enzyme Prediction     

No EC number prediction in MGYG000004748_02961.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM62	451	518	2.8e-17	0.5114503816793893
CBM62	526	586	7.1e-16	0.46564885496183206

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01841	Transglut_core	1.68e-07	186	277	6	101	Transglutaminase-like superfamily. This family includes animal transglutaminases and other bacterial proteins of unknown function. Sequence conservation in this superfamily primarily involves three motifs that centre around conserved cysteine, histidine, and aspartate residues that form the catalytic triad in the structurally characterized transglutaminase, the human blood clotting factor XIIIa'. On the basis of the experimentally demonstrated activity of the Methanobacterium phage pseudomurein endoisopeptidase, it is proposed that many, if not all, microbial homologs of the transglutaminases are proteases and that the eukaryotic transglutaminases have evolved from an ancestral protease.
smart00460	TGc	4.54e-04	226	277	1	60	Transglutaminase/protease-like homologues. Transglutaminases are enzymes that establish covalent links between proteins. A subset of transglutaminase homologues appear to catalyse the reverse reaction, the hydrolysis of peptide bonds. Proteins with this domain are both extracellular and intracellular, and it is likely that the eukaryotic intracellular proteins are involved in signalling events.
pfam00754	F5_F8_type_C	5.43e-04	536	609	6	80	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT35039.1	0.0	9	653	8	652
QUT66433.1	0.0	9	653	8	652
QQA29412.1	0.0	9	653	8	652
QUT60882.1	0.0	9	653	8	652
QUT97869.1	0.0	9	653	8	652

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2YB7_A	2.09e-06	451	517	70	137	ChainA, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],2YB7_B Chain B, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],2YFU_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],2YFZ_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],2YG0_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000055	1.000005	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004748_02961.