CAZyme Information: MGYG000004748_02989

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000004748_02989
• CAZy Family: GH140
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
473	MGYG000004748_20|CGC2	53971.72	6.824

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004748	4696076	MAG	China	Asia

• Gene Location: Start: 64056; End: 65477 Strand: +

Full Sequence      

MKNNILFSVCILLLSTLTYAQPTEIPWKHSPLQVSANSRYLQQADGAPFFWLGDTGWLLP
EKLNRDEAAYYLEHCKQAGFNVIQVQTINGVPAMNFYGQSSHPRGYDFSGTDQPGTYGYW
NHMDYIIETAERQGIYIGMVCIWGGLVKSGQMDVEQAKAYGTFLANRYKDHPNIIWIIGG
DTYGNLKTEVWEALATTIKSIDKNHLMTFHPFGRTLSTTWFNNAAWLDFNMFQSGHRRYE
QSKDNTNSILPIGTEEDNWRYVEISHSTKPMRPVIDGEPSYEAIPQGLHNPKEGFWQAED
VRRYAYWSVFAGAFGHTYGHNSIMQFLKPGVNAAYGATKLWYDALTDAGFNQMKYLKALI
LGFPFFERIPDQSIIAGENGEKYDRLIATRGTDYLLVYNYTGRSMEINIHKISGKTKKAW
WYSPRNGELSYIGEFSSKVTTFTPQGKQNNGNDWVLIVTDSAQDYVDNISKNK

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH140	31	456	5.1e-169	0.9951456310679612

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13204	DUF4038	3.42e-151	37	363	1	320	Protein of unknown function (DUF4038). A family of putative cellulases.
pfam12904	Collagen_bind_2	5.30e-46	369	459	1	92	Putative collagen-binding domain of a collagenase. This domain is likely to be the collagen-binding domain of a family of bacterial collagenase enzymes. It is the C-terminal part of the Structure 3kzs (information derived from TOPSAN).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT93192.1	4.37e-281	3	467	2	466
ALJ61272.1	1.45e-279	3	467	2	466
ADY37166.1	7.71e-235	3	466	6	467
BCA50077.1	1.26e-232	7	466	4	472
QUT70961.1	1.26e-232	7	466	4	472

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSY_A	4.49e-234	21	466	7	452	Glycosidehydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_B Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_C Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482]
3KZS_A	1.70e-224	21	466	7	452	Crystalstructure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_B Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_C Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_D Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482]
4QFU_A	6.37e-213	23	466	22	468	ChainA, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_B Chain B, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_C Chain C, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_D Chain D, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_E Chain E, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_F Chain F, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_G Chain G, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_H Chain H, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_I Chain I, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_J Chain J, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_K Chain K, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_L Chain L, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000290	0.998996	0.000208	0.000174	0.000160	0.000147

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004748_02989.