CAZyme Information: MGYG000004751_00567

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; CAG-521
• CAZyme ID: MGYG000004751_00567
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
312		34223.81	8.3607

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004751	1757901	MAG	China	Asia

• Gene Location: Start: 25104; End: 26042 Strand: +

Full Sequence      

MKPIVLCRLPNHVGDCCMTLPALRLLDASGFTPYLLGKRFAEDLMMGMGWRFDPIEGHVT
EDFKRLPYLSKQLNRPLGLLFPNSFTSALQFRLAGVRAAGFGTDGRFLLLDKSLPQPESE
VHEVERFFKVAYEAIKAWGGTPAWDKPTPELGLTLVQRHLAGAKNLRAELGISDRYALIA
PIARGIHHGKIKHWVHMNALCQPLKEMGIEPIVLPSPDEVEEAKVACPDARHLSPTNLGT
YAALAKDAQIVIANDSGISHVAAAVGARQLTLIGVTNPKRTGPWNPNATVMGNEQGWPEP
AEVIAKLKELLK

Enzyme Prediction     

No EC number prediction in MGYG000004751_00567.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	79	291	3e-27	0.8266666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01075	Glyco_transf_9	2.20e-29	77	296	15	232	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
COG0859	RfaF	2.53e-20	1	312	1	331	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	1.41e-17	5	309	2	277	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
TIGR02195	heptsyl_trn_II	1.48e-08	64	290	45	294	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK10422	PRK10422	2.28e-07	154	302	160	319	lipopolysaccharide core biosynthesis protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQS89241.1	8.09e-142	5	311	6	313
QDA55160.1	1.74e-137	5	310	4	309
BBF22597.1	3.97e-134	1	311	1	311
ANU65198.1	1.02e-105	8	311	7	309
QQQ96353.1	1.02e-105	8	311	7	309

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P45042	2.51e-06	77	291	82	305	ADP-heptose--LPS heptosyltransferase 2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=rfaF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004751_00567.