CAZyme Information: MGYG000004752_01500

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Roseburia
• CAZyme ID: MGYG000004752_01500
• CAZy Family: GT11
• CAZyme Description: O-antigen biosynthesis glycosyltransferase WbnK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
272	MGYG000004752_272|CGC1	31846.43	7.9317

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004752	1894066	MAG	China	Asia

• Gene Location: Start: 1735; End: 2553 Strand: -

Full Sequence      

MVVIKIGDGMGNQMFNYACGYALARRDGEKLKLDISECDNSSLRDYELDFFKVRYDAKES
FPNRNVWQKLYKRLRRNLKYHVIVEKDWFAEDKRIYRKYKRPRYLHGYWQNTVYFKEYLD
ELREMFAPREPLPVTVEELMRRFAGEPTCAVHVRGGDIDGPTPAYFREAMRRVKEQNPDM
TFIVFTNDAKKAAECIGVDEKSAGIQYIGDMGHFSDKEEFLLMSACQNQIISNSSYSTWA
AYLNRNPGQMVIMPGYKGAGQMCLPGWQMIEE

Enzyme Prediction     

No EC number prediction in MGYG000004752_01500.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT11	1	255	3.8e-54	0.9130434782608695

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11301	Fut1_Fut2_like	1.60e-39	1	252	3	249	Alpha-1,2-fucosyltransferase. Alpha-1,2-fucosyltransferases (Fut1, Fut2) catalyze the transfer of alpha-L-fucose to the terminal beta-D-galactose residue of glycoconjugates via an alpha-1,2-linkage, generating carbohydrate structures that exhibit H-antigenicity for blood-group carbohydrates. These structures also act as ligands for morphogenesis, the adhesion of microbes, and metastasizing cancer cells. Fut1 is responsible for producing the H antigen on red blood cells. Fut2 is expressed in epithelia of secretory tissues, and individuals termed "secretors" have at least one functional copy of the gene; they secrete H antigen which is further processed into A and/or B antigens depending on the ABO genotype. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
pfam01531	Glyco_transf_11	1.65e-22	10	271	41	298	Glycosyl transferase family 11. This family contains several fucosyl transferase enzymes.
cd11548	NodZ_like	2.96e-09	1	250	1	287	Alpha 1,6-fucosyltransferase similar to Bradyrhizobium NodZ. Bradyrhizobium NodZ is an alpha 1,6-fucosyltransferase involved in the biosynthesis of the nodulation factor, a lipo-chitooligosaccharide formed by three-to-six beta-1,4-linked N-acetyl-d-glucosamine (GlcNAc) residues and a fatty acid acyl group attached to the nitrogen atom at the non-reducing end. NodZ transfers L-fucose from the GDP-beta-L-fucose donor to the reducing residue of the chitin oligosaccharide backbone, before the attachment of a fatty acid group. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEN97523.1	3.09e-123	1	271	1	270
VCV23356.1	4.88e-103	1	271	1	292
CBL08052.1	4.88e-103	1	271	1	292
CBL12617.1	9.79e-101	1	271	67	358
QUS56900.1	7.55e-32	2	254	22	287

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58YV9	1.03e-14	6	254	5	282	O-antigen biosynthesis glycosyltransferase WbnK OS=Escherichia coli OX=562 GN=wbnK PE=1 SV=1
F6Q1T7	1.32e-07	11	243	90	317	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Bos taurus OX=9913 GN=FUT1 PE=1 SV=1
Q866E1	3.23e-07	87	243	149	318	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Alouatta belzebul OX=30590 GN=FUT1 PE=3 SV=1
Q866E4	3.23e-07	87	243	149	318	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Alouatta caraya OX=9502 GN=FUT1 PE=3 SV=1
Q866F1	5.80e-07	11	243	91	318	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Saimiri sciureus OX=9521 GN=FUT1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004752_01500.