CAZyme Information: MGYG000004753_00680

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; RUG705
• CAZyme ID: MGYG000004753_00680
• CAZy Family: GH108
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
142		16492.72	7.9471

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004753	1403340	MAG	China	Asia

• Gene Location: Start: 3907; End: 4335 Strand: +

Full Sequence      

MAYFGDAFKKLSIKEGGYVNDKDDAGGETYKGISRKYNPTWQGWTMIDSYKKHYTVGSKE
FKSKLDNDVQLQKLVWEKYKIGYWDVFELDDFNSQRVAEQLFDTNVNCGQVAAIKMAQRV
LGLKETGRWNLDLLNKLIEIKD

Enzyme Prediction     

No EC number prediction in MGYG000004753_00680.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH108	9	109	4.5e-17	0.9651162790697675

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05838	Glyco_hydro_108	2.08e-20	15	109	8	86	Glycosyl hydrolase 108. This family acts as a lysozyme (N-acetylmuramidase), EC:3.2.1.17. It contains a conserved EGGY motif near the N-terminus, the glutamic acid within this motif is essential for catalytic activity. In bacteria, it may activate the secretion of large proteins via the breaking and rearrangement of the peptidoglycan layer during secretion. It is frequently found at the N-terminus of proteins containing a C-terminal pfam09374 domain.
cd13926	N-acetylmuramidase_GH108	4.36e-12	2	109	1	91	N-acetylmuramidase domain of the glycosyl hydrolase 108 family. This domain acts as a lysozyme (N-acetylmuramidase), EC:3.2.1.17. It contains a conserved EGGY motif near the N-terminus, the glutamic acid within this motif is essential for catalytic activity. In bacteria, it may activate the secretion of large proteins via the breaking and rearrangement of the peptidoglycan layer during secretion. It is frequently found at the N-terminus of proteins containing a peptidoglycan binding domain.
COG3926	ZliS	2.27e-10	15	128	16	111	Lysozyme family protein [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOR56522.1	7.72e-104	1	142	1	142
QPD07323.1	7.72e-104	1	142	1	142
QOR56602.1	1.10e-103	1	142	1	142
QIN93321.1	3.15e-103	1	142	1	142
QOR56442.1	4.47e-103	1	142	1	142

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2NR7_A	4.33e-06	15	127	18	119	StructuralGenomics, the crystal structure of putative secretion activator protein from Porphyromonas gingivalis W83 [Porphyromonas gingivalis W83]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004753_00680.