CAZyme Information: MGYG000004754_00154

Basic Information

• Species: Elizabethkingia bruuniana
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Flavobacteriales; Weeksellaceae; Elizabethkingia; Elizabethkingia bruuniana
• CAZyme ID: MGYG000004754_00154
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
501	MGYG000004754_1|CGC6	58084.09	9.0963

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004754	4072783	MAG	China	Asia

• Gene Location: Start: 174427; End: 175932 Strand: -

Full Sequence      

MRKSMFNLSLLTGLCMCALMQAQAWTGEKQDKPKERVALKYGPITPAHRTDEAMRKFREY
GLGQFIHWGIYAIPGNEWNGVSARGGAAASEWIRSWSGPTAPKDWKNIYDNLYKQFNPKD
FDAKRWAKQAKDMGAKYVIFTTKHHDGFALWPTKYSAYNITKTPYKKDIVKQIVDAYDAE
GIDVFLYFSILEWNNPDYLYKAPQTAEEKAKYSKFLKYTENQLLELLKNYPQIKGFWFDG
TWDASWKSAYEFTYNLEKKLREKHPGLIIGSRFRNDENQKRHFDTNGDLLGDYEQGWERK
LPKNYESLNGNDWDCVMTIPPNGWGYMKDWNGIYTKTPDDLIEMLMRSRSMGGNFVINFG
PDGNGNFHPEEDKIMKEIGEWTKVNAEAIYNVEHSPMSLSNYGYFTKKGNNTYLTVFNRP
VNQIVRLAVDKKATEVPTSASLLIGNRKLELKQSDMGLDLDKNTYYDIILPKDYQTDKAF
VIKIEMKQGSVKTDKLMDAKM

Enzyme Prediction     

No EC number prediction in MGYG000004754_00154.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	35	391	1.7e-91	0.9364161849710982

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00812	Alpha_L_fucos	1.24e-93	38	427	4	381	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
pfam01120	Alpha_L_fucos	2.28e-80	57	387	22	333	Alpha-L-fucosidase.
COG3669	AfuC	1.32e-36	67	391	1	321	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam14871	GHL6	4.58e-09	122	199	1	77	Hypothetical glycosyl hydrolase 6. GHL6 is a family of hypothetical glycoside hydrolases.
pfam14488	DUF4434	0.002	120	275	17	166	Domain of unknown function (DUF4434).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATL43165.1	0.0	1	501	1	501
AJW61588.1	0.0	1	501	1	501
QHQ85668.1	0.0	1	501	1	501
QNV08151.1	0.0	1	501	1	501
QGN21488.1	0.0	1	501	1	501

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WVT_A	4.67e-140	34	487	3	440	Crystalstructure of an alpha-L-fucosidase GH29 from Bacteroides thetaiotaomicron in complex with a novel iminosugar fucosidase inhibitor [Bacteroides thetaiotaomicron VPI-5482],2WVT_B Crystal structure of an alpha-L-fucosidase GH29 from Bacteroides thetaiotaomicron in complex with a novel iminosugar fucosidase inhibitor [Bacteroides thetaiotaomicron VPI-5482],2WVU_A Crystal structure of a Michaelis complex of alpha-L-fucosidase GH29 from Bacteroides thetaiotaomicron with the synthetic substrate 4- nitrophenyl-alpha-L-fucose [Bacteroides thetaiotaomicron VPI-5482],2WVU_B Crystal structure of a Michaelis complex of alpha-L-fucosidase GH29 from Bacteroides thetaiotaomicron with the synthetic substrate 4- nitrophenyl-alpha-L-fucose [Bacteroides thetaiotaomicron VPI-5482],2WVU_C Crystal structure of a Michaelis complex of alpha-L-fucosidase GH29 from Bacteroides thetaiotaomicron with the synthetic substrate 4- nitrophenyl-alpha-L-fucose [Bacteroides thetaiotaomicron VPI-5482],2WVU_D Crystal structure of a Michaelis complex of alpha-L-fucosidase GH29 from Bacteroides thetaiotaomicron with the synthetic substrate 4- nitrophenyl-alpha-L-fucose [Bacteroides thetaiotaomicron VPI-5482]
2XIB_A	6.51e-140	34	487	2	439	CrystalStructure Of An Alpha-L-Fucosidase Gh29 From Bacteroides Thetaiotaomicron In Complex With Deoxyfuconojirimycin [Bacteroides thetaiotaomicron],2XIB_B Crystal Structure Of An Alpha-L-Fucosidase Gh29 From Bacteroides Thetaiotaomicron In Complex With Deoxyfuconojirimycin [Bacteroides thetaiotaomicron],2XIB_C Crystal Structure Of An Alpha-L-Fucosidase Gh29 From Bacteroides Thetaiotaomicron In Complex With Deoxyfuconojirimycin [Bacteroides thetaiotaomicron],2XIB_D Crystal Structure Of An Alpha-L-Fucosidase Gh29 From Bacteroides Thetaiotaomicron In Complex With Deoxyfuconojirimycin [Bacteroides thetaiotaomicron],2XII_A Crystal Structure Of An Alpha-L-Fucosidase Gh29 From Bacteroides Thetaiotaomicron In Complex With An Extended 9- Fluorenone Iminosugar Inhibitor [Bacteroides thetaiotaomicron],2XII_B Crystal Structure Of An Alpha-L-Fucosidase Gh29 From Bacteroides Thetaiotaomicron In Complex With An Extended 9- Fluorenone Iminosugar Inhibitor [Bacteroides thetaiotaomicron]
4JL2_A	1.18e-139	37	487	2	436	Crystalstructure of a bacterial fucosidase with a monovalent iminocyclitol inhibitor [Bacteroides thetaiotaomicron VPI-5482],4JL2_B Crystal structure of a bacterial fucosidase with a monovalent iminocyclitol inhibitor [Bacteroides thetaiotaomicron VPI-5482]
2WVS_A	1.33e-139	34	487	3	440	Crystalstructure of an alpha-L-fucosidase GH29 trapped covalent intermediate from Bacteroides thetaiotaomicron in complex with 2- fluoro-fucosyl fluoride using an E288Q mutant [Bacteroides thetaiotaomicron VPI-5482],2WVS_B Crystal structure of an alpha-L-fucosidase GH29 trapped covalent intermediate from Bacteroides thetaiotaomicron in complex with 2- fluoro-fucosyl fluoride using an E288Q mutant [Bacteroides thetaiotaomicron VPI-5482],2WVS_C Crystal structure of an alpha-L-fucosidase GH29 trapped covalent intermediate from Bacteroides thetaiotaomicron in complex with 2- fluoro-fucosyl fluoride using an E288Q mutant [Bacteroides thetaiotaomicron VPI-5482],2WVS_D Crystal structure of an alpha-L-fucosidase GH29 trapped covalent intermediate from Bacteroides thetaiotaomicron in complex with 2- fluoro-fucosyl fluoride using an E288Q mutant [Bacteroides thetaiotaomicron VPI-5482]
6HZY_A	1.34e-139	34	487	24	461	Crystalstructure of a bacterial fucosidase with inhibitor FucPUG [Bacteroides thetaiotaomicron VPI-5482],6HZY_B Crystal structure of a bacterial fucosidase with inhibitor FucPUG [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49713	4.86e-35	62	418	39	388	Putative alpha-L-fucosidase OS=Caenorhabditis elegans OX=6239 GN=W03G11.3 PE=3 SV=2
Q60HF8	5.47e-35	40	427	38	412	Tissue alpha-L-fucosidase OS=Macaca fascicularis OX=9541 GN=FUCA1 PE=2 SV=1
P17164	1.29e-34	41	431	33	410	Tissue alpha-L-fucosidase OS=Rattus norvegicus OX=10116 GN=Fuca1 PE=1 SV=1
P04066	1.37e-34	18	427	14	410	Tissue alpha-L-fucosidase OS=Homo sapiens OX=9606 GN=FUCA1 PE=1 SV=4
Q99LJ1	1.53e-34	57	431	39	400	Tissue alpha-L-fucosidase OS=Mus musculus OX=10090 GN=Fuca1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001248	0.657942	0.339719	0.000491	0.000310	0.000270

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004754_00154.