CAZyme Information: MGYG000004754_02442

Basic Information

• Species: Elizabethkingia bruuniana
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Flavobacteriales; Weeksellaceae; Elizabethkingia; Elizabethkingia bruuniana
• CAZyme ID: MGYG000004754_02442
• CAZy Family: GT83
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
515		60424.07	9.7047

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004754	4072783	MAG	China	Asia

• Gene Location: Start: 73970; End: 75517 Strand: -

Full Sequence      

MKGNFTNSDRFIKTTVLFSFIILKFLIQYSLILPEYDLQRDEYLHLDQANHLAWGYLSVP
PVTSWISYIIKLLGNSVFWIKFFPALFGVLTTIVVWKTIEELGGNLFALILGASCITFSV
LFRLNTLYQPNSLDVLCWTLLYFFIIKYINQHQFKWLYYAAITFAFGFLNKYNIVFAVIG
LLPAFIITPERKIFLNKKLYFILALVFVLILPNLLWQYQNNLPVIHHMKELADTQLVNVN
RLDFIRSQFLFFPGTNIIILLGLYSLFRYQSFKKFRLLFWSFFITLGIFLFLKAKDYYAI
GVYPVYFAFGSVYIAHLLEKKSLKILKPVCIILAIASFIPMYLVAFPNRSPDYYITHKET
FHKLGMLRWEDGKEYPLPQDFADMLGWKELANKVDKAYLEFNDPAHTLVLCDNYGQAGAI
NFYSKYGIRAVSFNADYINWFDLHKKYIYLIRVKNQSERNNELKETSPFFKHSVIADSVT
NKYAREYGATIFSFSNAKIDIRPRLQEEINKVKAR

Enzyme Prediction     

No EC number prediction in MGYG000004754_02442.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	33	345	5.1e-22	0.6203703703703703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13231	PMT_2	1.99e-25	58	216	1	160	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
COG1807	ArnT	3.01e-14	55	353	60	381	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam02366	PMT	2.57e-06	52	187	55	198	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG4745	COG4745	4.82e-04	69	188	76	195	Predicted membrane-bound mannosyltransferase [General function prediction only].

CAZyme Hits     

MGYG000004754_02442 has no CAZyme hit.

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000031	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
16	33
53	70
77	96
106	125
132	149
164	186
199	218
249	268
275	292
296	318
325	347