CAZyme Information: MGYG000004755_01770

Basic Information

• Species: UBA7741 sp900314575
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Atopobiaceae; UBA7741; UBA7741 sp900314575
• CAZyme ID: MGYG000004755_01770
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
605		68316.83	4.7643

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004755	2082056	MAG	China	Asia

• Gene Location: Start: 1; End: 1818 Strand: -

Full Sequence      

MAGTTYPAEATVEVVARLEPELAPTGCAVDSFDPGAARLDAGSELFDQQQRSLAFLLTVD
DDQMLYNFRATAGLDTLGAPQMVGWDAPECLLRGHTTGHYLSALARCYLATGDVRVREKA
AYLVASLAACQRALERVPGVHAGYLMGFPEEQFDRLERYVRYPEVWAPYYTFHKVLAGLL
DCYDAFGDGLALKVAEGMGAWAHERLSRLSHEELTTMWGIYIAGEFGGMNDALARLYERT
GRHEFIDAARLFDNDKLFVPMEQGVDTLEDVHANQHIPQVIGALRLFEDTGERRYLDIAR
NFWDIVVGAHVYAIGGTGESEMWHHPNRVARQLSEHTAESCCSYNMVKLTRGLYRHERRP
EMLDYYERTMLNHVLASGDKHARGARTYFMPLAPGFHKEFDNENSCCHGTGLEDDFMYAD
GIYYHTDDELEVALFVPSHVDWEERGVAVWQQVEQDRRGFRVVVSFAGTDSRFRLRVRRP
LWADPEGLLLDGEPAKVATTRDGRWLELERTWHDGDSLEFRLPCSSRLEAAPDDPDKVVV
CWGPYVLAFLTPSSDFLRLGTDERPLDEVLVQDGDGPSFVVAGTGTRVRPLCMLEGEDYQ
VYVRR

Enzyme Prediction     

No EC number prediction in MGYG000004755_01770.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	43	548	2.8e-177	0.9860834990059643

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	3.42e-132	47	548	11	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.89e-66	49	565	23	510	Uncharacterized conserved protein, DUF1680 family [Function unknown].
cd04434	LanC_like	0.001	103	250	10	184	Cyclases involved in the biosynthesis of lantibiotics, and similar proteins. LanC is the cyclase enzyme of the lanthionine synthetase. Lanthionine is a lantibiotic, a unique class of peptide antibiotics. They are ribosomally synthesized as a precursor peptide and then post-translationally modified to contain thioether cross-links called lanthionines (Lans) or methyllanthionines (MeLans), in addition to 2,3-didehydroalanine (Dha) and (Z)-2,3-didehydrobutyrine (Dhb). These unusual amino acids are introduced by the dehydration of serine and threonine residues, followed by thioether formation via addition of cysteine thiols, catalysed by LanB and LanC or LanM. LanC, the cyclase component, is a zinc metalloprotein, whose bound metal has been proposed to activate the thiol substrate for nucleophilic addition. A related domain is also present in LanM and other pro- and eukaryotic proteins with poorly characterized functions.
cd04792	LanM-like	0.001	175	260	597	689	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOS77131.1	2.54e-205	4	605	161	764
ASR48105.1	3.22e-187	1	604	158	757
AWY98728.1	2.21e-186	1	604	160	753
AET60941.1	7.50e-185	3	604	166	764
ASR47498.1	1.16e-184	3	604	166	764

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	4.01e-68	43	596	38	597	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	3.31e-64	43	563	38	575	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004755_01770.