CAZyme Information: MGYG000004756_00582

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes
• CAZyme ID: MGYG000004756_00582
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
376		42851.25	7.3482

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004756	2379647	MAG	China	Asia

• Gene Location: Start: 48035; End: 49165 Strand: -

Full Sequence      

MKYYLIAGEASGDLHGSNLMQGLLKSDPAAEFRFWGGDRMAEVGGRENRVRDYRETSFFG
IVGVLRNLGTISRQLRECREDLLRYGPDVLILIDYPGFNMKMARFAKEHGIRTFYYIAPK
VWAWREWRVKAIRKYVERLYIIFPFERGYFPKHGIQPVFEGNPLLDAIAARAETLPSREE
FGRTNGLDARPVVALVAGSRRGEIDANLPLMCALAPRFPEYQFVVTGVSWLDRALYDRYL
TGTEVRFVCDQTYETLHNAEAAVVTSGTATLETALMRIPEVVIYRTVWWQVWLRPYVLKV
PFISLVNLNLGREAVRELVQSSADPAEAERALRTILPGGPERERMLGDYDELLTVMGGPG
ASDRFAADMVKELRHD

Enzyme Prediction     

No EC number prediction in MGYG000004756_00582.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	354	2.6e-102	0.9830508474576272

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.98e-97	1	373	2	374	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.29e-94	1	373	2	378	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	2.22e-68	4	364	2	366	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	2.02e-64	5	367	10	380	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.29e-40	1	325	2	306	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL13420.1	5.31e-252	1	374	1	374
BBL04027.1	8.79e-251	1	374	1	374
AFL77950.1	9.72e-203	1	373	1	373
BBL11605.1	3.95e-202	1	374	1	374
BBL08813.1	3.95e-202	1	374	1	374

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	8.19e-43	5	352	11	361	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.60e-42	5	352	11	361	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q74AT9	9.79e-66	2	373	8	380	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q2LVL8	4.92e-62	5	366	8	371	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q39T49	7.11e-62	2	373	8	380	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q1D393	5.37e-61	2	373	6	377	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
B3E4H8	2.29e-59	2	366	8	373	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004756_00582.