CAZyme Information: MGYG000004756_00742

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes
• CAZyme ID: MGYG000004756_00742
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
734		83014.58	7.0068

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004756	2379647	MAG	China	Asia

• Gene Location: Start: 20849; End: 23053 Strand: +

Full Sequence      

MNPKKTLFALLFAAGLHTAAGQTPLYENKAFVLYPDRVAQGLFNGTAEAPDRIVSNFASP
HTKDDGMNYAWKCKNDLSAYPRYESEFPIEVAVYNLGLDEMVNAVERNLTLRTGAQWGGI
WTRDVSYSILLAMAYMQPTAARNSLLRKIDDLGRVVQDTGTGGSWPCSSDRMIWAAAAWE
IYKTTGDRDWLRTVYEPIRRSAETDRRVVFDERTGLYRGESSFIDWREQSYPAWMQPADI
YESKCLGTNAVHYRTLDILGKMARTLGKPADAERYAAQAAQLKTAINDRLWIEERGYYAQ
YLYGRRGELRSPRSETLGEALAILFGIASAEQSRLIVNRMPLTNFGPTVFYPQIPDQYAY
HNDAVWPFVTSFWMLAASKAGNEEAVKHAAASTYRAALLFATNKENFRAHDGDWAYTKVN
SSNMLWSLSGNLSIVFRLYFGMRFEEEALRFDPFVPRSMACRRTLSDFPYQKATLTLELE
GYGGRIRSFTLDGKSCPPVIPATLSGRHHVRIVLDNSFSQSDAGINLTAQRNSLATPRAE
LDGSRLHWQPVEGAVSYTVLRNYKPYKTVAETELTLDDKESGEYQVMADAAVPLLSSFAS
EPVVWGARDKWEQSFIPVRLDEKQRSGYRTQTSVPIDGIYAIDWEYANGNGGVTNRNMCA
IRSLYVDGQRAGTVVLPQRGKEEWENFGWSNPVQLRLTPGNHTVELRYETGDRNMNIETN
SAVIRTLRFMRIEE

Enzyme Prediction     

No EC number prediction in MGYG000004756_00742.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	120	384	5.8e-27	0.4642857142857143

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.74e-17	99	299	10	222	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam06202	GDE_C	2.34e-09	170	398	84	332	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).
COG3408	GDB1	1.68e-08	115	384	279	555	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
cd04083	CBM35_Lmo2446-like	4.57e-08	629	712	40	114	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.
TIGR01577	oligosac_amyl	1.45e-05	177	300	361	467	oligosaccharide amylase. The name of this type of amylase is based on the characterization of an glucoamylase family enzyme from Thermoactinomyces vulgaris. The T. vulgaris enzyme was expressed in E. coli and, like other glucoamylases, it releases beta-D-glucose from starch. However, unlike previously characterized glucoamylases, this T. vulgaris amylase hydrolyzes maltooligosaccharides (maltotetraose, maltose) more efficiently than starch (1), indicating this enzyme belongs to a class of glucoamylase-type enzymes with oligosaccharide-metabolizing activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDA62675.1	2.24e-221	71	733	201	882
QNK61875.1	8.69e-221	70	733	215	892
QEC42842.1	1.63e-219	71	734	217	897
ARS34527.1	1.01e-218	71	732	223	899
AMQ00027.1	1.38e-215	70	732	199	875

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5X7G_A	7.27e-06	633	712	445	516	CrystalStructure of Paenibacillus sp. 598K cycloisomaltooligosaccharide glucanotransferase [Paenibacillus sp. 598K],5X7H_A Crystal Structure of Paenibacillus sp. 598K cycloisomaltooligosaccharide glucanotransferase complexed with cycloisomaltoheptaose [Paenibacillus sp. 598K]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000266	0.999074	0.000212	0.000150	0.000143	0.000131

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004756_00742.