CAZyme Information: MGYG000004756_01696

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes
• CAZyme ID: MGYG000004756_01696
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
326		35683.29	8.6575

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004756	2379647	MAG	China	Asia

• Gene Location: Start: 15964; End: 16944 Strand: -

Full Sequence      

MGDVAMLPHALRALRGAYPDVRITVLTRPLFKPFFAGLDVDFLEADYDGLHKGLSGLSRL
AGEAQRRGVDAVADVHGVLRSRIIGLLLRLRGMRTARIDKGRIEKWFRLGCSNPAAAPLK
HTVIRYCDVLRRLGFVFGDPQPAAKSVRPNPFGEKRGVWVGFAPFSAQTGKTYPEELAAE
AVAGLSARYDRVFIHSGGGDEAAFAEAMERKYPNVTALWGRLRLAGELDLIANLDCIVSM
DSLAMHMASLVATPVVSVWGATHPSLGFLGYGCSTEGEVQLDLPCRPCSVYGQRPCKFGD
YRCMRIPPQAIVDRVEALIAETRDEK

Enzyme Prediction     

No EC number prediction in MGYG000004756_01696.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	63	300	2.1e-32	0.9466666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	3.04e-38	1	317	10	277	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam01075	Glyco_transf_9	6.06e-13	59	301	3	246	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10422	PRK10422	2.39e-05	84	262	100	291	lipopolysaccharide core biosynthesis protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL13855.1	1.74e-206	1	326	13	338
BBL04346.1	2.47e-206	1	326	13	338
BBL07004.1	8.62e-149	1	319	1	320
AFL77232.1	4.30e-144	1	321	20	341
BBL09491.1	2.56e-143	1	321	1	322

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004756_01696.