CAZyme Information: MGYG000004757_00836

Basic Information

• Species: UBA6398 sp900555645
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; UBA6398; UBA6398 sp900555645
• CAZyme ID: MGYG000004757_00836
• CAZy Family: GH18
• CAZyme Description: Chitinase A1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
332		36846.91	8.5341

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004757	2504990	MAG	China	Asia

• Gene Location: Start: 423; End: 1421 Strand: +

Full Sequence      

MKRFLFIICTIAFATTASFAKSGRVVIAYVTSWSHIMPDPAYVTHVFYAFGGVNETFNGI
NISNPERLKSIAGLKENNPKLKVVLSVGGWGSGRFSEMAADETLRKSFCADCKRVIDEYN
LDGIDIDWEYPGSSSANISSSPNDRKNFTLLMHDIRSAIGKASVLSIATAAWGNFYDFRD
FIDDLDFVNVMSYDMGNAPTHHAALYNSDITGKGMTCEKAVNAHIEGGVPTGKLVLGLPF
YGRGTQAVGNFCDFRKIADLKGYTEKWDKQASVPYLEDSNGTIVLCFDNARSLKAKCKYL
KKKGLHGSMYWDYAGDDEKGTLRKTVWKNTRR

Enzyme Prediction     

No EC number prediction in MGYG000004757_00836.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	25	323	5e-69	0.956081081081081

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06548	GH18_chitinase	3.29e-83	26	316	1	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
smart00636	Glyco_18	1.82e-68	25	316	1	334	Glyco_18 domain.
pfam00704	Glyco_hydro_18	5.49e-66	25	316	1	307	Glycosyl hydrolases family 18.
cd02872	GH18_chitolectin_chitotriosidase	8.80e-62	26	321	1	346	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.
COG3325	ChiA	5.44e-50	24	326	38	432	Chitinase, GH18 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT34047.1	4.76e-130	20	329	30	338
ADV45176.1	4.76e-130	22	328	32	337
QDO71383.1	2.46e-124	1	328	1	336
QUT62465.1	7.55e-124	20	329	24	333
ALJ58703.1	9.02e-124	22	329	32	339

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6INX_A	2.82e-50	43	316	27	329	Structuralinsights into a novel glycoside hydrolase family 18 N-acetylglucosaminidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii]
6TSB_AAA	2.63e-49	39	326	50	346	ChainAAA, Peroxiredoxin [Clostridioides difficile 630]
6T9M_AAA	4.10e-49	39	326	69	365	ChainAAA, Peroxiredoxin [Clostridioides difficile 630]
6KST_A	3.81e-45	26	316	9	357	Crystalstructure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KST_B Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KXL_A Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXL_B Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6KXM_A	2.05e-44	26	316	9	357	Crystalstructure of D157N mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXM_B Crystal structure of D157N mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P20533	5.24e-41	16	324	37	446	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
Q13231	2.74e-38	22	320	20	367	Chitotriosidase-1 OS=Homo sapiens OX=9606 GN=CHIT1 PE=1 SV=1
Q9W092	3.21e-34	24	323	41	396	Probable chitinase 2 OS=Drosophila melanogaster OX=7227 GN=Cht2 PE=1 SV=1
P36362	6.66e-34	1	320	1	379	Endochitinase OS=Manduca sexta OX=7130 PE=2 SV=1
Q9D7Q1	1.21e-32	22	322	20	367	Chitotriosidase-1 OS=Mus musculus OX=10090 GN=Chit1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000316	0.998999	0.000180	0.000160	0.000158	0.000143

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004757_00836.